Detailed information on CNT30203418


BLAST search results

BLAST vs Swiss-Prot:
sp|P17786|EF1A_SOLLC, E-value = 7e-71

BLAST vs NONCODE:
NONBNAT007048, E-value = 9e-57

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673342Helianthus annuusSetaria viridis72.6231.9785.19297forward
CNT3021028Helianthus annuusCitrullus lanatus51.8317.0787.26212forward
CNT30505987Helianthus annuusNicotiana attenuata42.0552.2884.88172forward
CNT30296842Helianthus annuusTriticum aestivum52.0830.5687.79213forward
CNT30509929Helianthus annuusSolanum lycopersicum36.6770.0987.33150forward
CNT3076676Helianthus annuusBrassica juncea99.7635.8283.33408forward
CNT30480841Helianthus annuusArabidopsis halleri41.5627.3887.06170forward
CNT30368448Helianthus annuusSorghum bicolor51.5937.4185.78211forward
CNT3024873Helianthus annuusPopulus trichocarpa51.5937.4186.26211forward
CNT30147611Helianthus annuusBrachypodium distachyon39.612785.8162forward
CNT30585575Helianthus annuusEchinochloa crusgalli51.8341.4987.74212forward
CNT30113122Helianthus annuusFicus carica51.125.1885.65209forward
CNT3050518Helianthus annuusCucumis sativus96.8263.7779.55396forward

Expression of CNT30203418

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MVTTIPGLITPVSTRPTGTVPIPPILYTS*

>peptide 2 (52 aa)
MMMTCEVKLAAPLAGSSLELDATYPRFRSLTATFLTLNPTLSPGRASCSASW*

Sequence

>CNT30203418
GAGAACTGGAGCGTAACCGTTTCCGATCTGACCAGGGTGGTTCATGATGATGACTTGTGAGGTGAAACTGGCGGCGCCCTTAGCGGGGTCGTCCTTGGAG
TTGGATGCGACATACCCACGTTTCAGATCCTTAACCGCAACGTTCTTGACGTTGAACCCAACGTTGTCACCGGGGAGAGCTTCTTGTAGCGCTTCATGGT
GACAACCATACCGGGCTTGATCACACCGGTTTCAACACGTCCGACAGGCACAGTTCCAATACCTCCGATCTTGTACACGTCCTGAAGTGGTAGACGAAGG
GGTTTGTCTGATGGCCGTTTTGGCTCGTTGATCTGGTCAAGAGCTTCGAGAAGAGTTGGGCCCTTGTACCAGTCGAGGTTTGTCGACCTCTCAATCATGT
TGTCACCCT