Detailed information on CNT30203004


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH33|UBQ11_ARATH, E-value = 4e-101

BLAST vs NONCODE:
NONMTRT002043, E-value = 3e-59

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30379273Helianthus annuusManihot esculenta39.8667.3684.87456forward
CNT30506303Helianthus annuusNicotiana attenuata40.1256.1886.06459forward
CNT30562220Helianthus annuusActinidia chinensis39.6955.9186.12454forward
CNT30312265Helianthus annuusCamelina sativa40.6569.6186.67465forward
CNT3074284Helianthus annuusBrassica juncea39.7765.6685.93455forward
CNT30477838Helianthus annuusArabidopsis halleri39.7780.8285.93455forward
CNT30354620Helianthus annuusLactuca sativa39.862687.28456forward

Expression of CNT30203004

Peptides detected in this lncRNA

>peptide 1 (68 aa)
KHNPKHTILFTIKEHSNIIQTPPQSHSLTSEQILKIHHGDGEQDEGSTPSGCCNPPRFGHPRAAFQRR*

>peptide 2 (45 aa)
MSLCWSGGIPSLSWILALTLSMVSELSTSRVIVFPVRVLTKICIC*

>peptide 3 (88 aa)
MKGRLLLDVVIRQGSAILELLSSEDEPLLVRWNTFLVLDFSFDIVNGVRALNFKGDCLSGESFDEDLHATTETEDQVEGGLLLDVVVS*

>peptide 4 (61 aa)
MSLCWSGGIPSLSWILALTLSMVSELSTSRVIVFPVRVLTKICMPPRRRRTKWRVDSFWML*

Sequence

>CNT30203004
GAAACATAATCCCAAACACACCATTTTATTCACCATCAAAGAACACAGTAACATAATCCAAACACCTCCACAATCACACAGCTTAACATCTGAACAAATC
CTTAAAATCCACCACGGAGACGGAGAACAAGATGAAGGGTCGACTCCTTCTGGATGTTGTAATCCGCCAAGGTTCGGCCATCCTCGAGCTGCTTTCCAGC
GAAGATGAGCCTCTGCTGGTCCGGTGGAATACCTTCCTTGTCTTGGATTTTAGCTTTGACATTGTCAATGGTGTCAGAGCTCTCAACTTCAAGGGTGATT
GTCTTTCCGGTGAGAGTTTTGACGAAGATCTGCATGCCACCACGGAGACGGAGGACCAAGTGGAGGGTGGACTCCTTCTGGATGTTGTAGTCAGCTAGGG
TTCTGCCATCTTCAAGTTGTTTTCCGGCAAAGATGAGCCTTTGCTGGTCTGGAGGGATTCCTTCCTTGTCCTGGATTTTGGCCTTGACGTTGTCAATGGT
ATCCGAGCTCTCTACTTCGAGAGTGATTGTCTTTCCGGTAAGAGTCTTAACGAAGATCTGCATCTGTTAACACAAACCAATTACACCATTAGAAACCTAT
ATATTCATGACCAAATGCTTGTTAAATAGCCAGCCCAGATGAATCGATTCATAAGATTATATATAAAAAAACAGTAACTGAATCAAACAGATTACAAATC
AAACGCTTGTCCAAAAGACATATTAAGTAATTCAAAAATTGATTATCAAAACCTAATCAATTATTTGAATTGAATCAATAACCACAGATTAATTCATCAA
AATCTCTATCTGTTGTAAAATCGCTAGTTCGAAGAAATTATAAAAGGTTCATCGATCGGTTAAAACGAAAACAATAAACACAATTCAATTGACTCAGAAC
CAGATATTCACAAAGAACAAAAGTATCAATCAAATTCTTAGTCAATTTCTCCAATCAGGAGTTACAGATCTAATACTTGTCCAAAAGCCAGATTAAACGT
AATCAGGACCATAAACACAGAATAATCATCAAAATCTCATAATATCCTTTCTTATCAATCCACAAACAATTAAATTATCGATCGATGGAAACGAAAAGCA
AAATTTAATTGGAATCGATTAAGAACCAAATAATAATTCAAAAT