Detailed information on CNT30202642


BLAST search results

BLAST vs Swiss-Prot:
sp|P07370|CB2B_SOLLC, E-value = 5e-113

BLAST vs NONCODE:
NONBNAT005173, E-value = 4e-44

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30514020Helianthus annuusJuglans regia48.8330.7385.66272forward
CNT30702989Helianthus annuusQuercus lobata58.5334.1481.6326forward
CNT30374501Helianthus annuusArabidopsis thaliana45.2445.6582.14252forward
CNT30269180Helianthus annuusChenopodium quinoa63.0258.1184.33351forward
CNT30728214Helianthus annuusCorchorus capsularis58.5338.7284.36326forward
CNT30380511Helianthus annuusManihot esculenta38.9630.8285.25217forward
CNT30629674Helianthus annuusVigna unguiculata43.4542.8383.47242forward
CNT30504491Helianthus annuusNicotiana attenuata59.7835.1386.19333forward
CNT30709869Helianthus annuusGlycine max82.2376.7284.06458forward
CNT3046345Helianthus annuusPrunus dulcis38.643.7987.44215forward
CNT30633568Helianthus annuusCapsicum annuum59.7835.8186.49333forward
CNT3091645Helianthus annuusSolanum tuberosum59.7830.6187.69333forward
CNT30562282Helianthus annuusActinidia chinensis60.3250.5384.23336forward
CNT30541860Helianthus annuusBrassica napus44.3440.6284.62247forward
CNT30508817Helianthus annuusSolanum lycopersicum59.7833.5787.09333forward
CNT30171121Helianthus annuusTrifolium pratense54.434.5183.17303forward
CNT30145117Helianthus annuusMedicago truncatula43.0926.0986.67240forward
CNT3079822Helianthus annuusBrassica juncea44.3425.4985.02247forward
CNT30263433Helianthus annuusBrassica rapa44.3455.2684.21247forward
CNT30598305Helianthus annuusFraxinus excelsior50.9941.5885.21284forward
CNT30609983Helianthus annuusGossypium raimondii59.7841.3782.58333forward
CNT30217700Helianthus annuusKalanchoe fedtschenkoi55.1238.9182.74307forward
CNT30714756Helianthus annuusMalus domestica golden78.4643.0582.38437forward
CNT30355191Helianthus annuusLactuca sativa52.9645.6790.17295forward
CNT30429024Helianthus annuusPapaver somniferum57.0925.8381.45318forward
CNT30646148Helianthus annuusCannabis sativa40.3955.1584.44225forward
CNT3036398Helianthus annuusCucumis melo49.3749.6481.82275forward
CNT30337332Helianthus annuusCynara cardunculus59.2524.9893.03330forward
CNT30725370Helianthus annuusLupinus angustifolius59.7831.4784.38333forward

Expression of CNT30202642

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MNQTWVAQVVKPTLAEDLGSGLEPDRLTELNTVSG*

>peptide 2 (45 aa)
CGIRPSVVGHGVSKTQRVEAATRVKWVHNLTKGSTSNSVTLNSTH*

>peptide 3 (47 aa)
LWHTTKRCWPRGQQDPTGRSCHQGKVGPQPHQGVHQQFCNPQQHPLR*

Sequence

>CNT30202642
TTGTGGCATACGACCAAGCGTTGTTGGCCACGGGGTCAGCAAGACCCAACGGGTCGAAGCTGCCACCAGGGTAAAGTGGGTCCACAACCTCACCAAGGGG
TCCACCAGCAATTCTGTAACCCTCAACAGCACCCATTAAGATGACTTGTGTAGCCCAAATGGCCAAGATGCTCTGGGCATGAATCAAACTTGGGTTGCCC
AAGTAGTCAAGCCCACCCTCGCTGAAGATTTGGGCTCCGGCCTTGAACCAGACCGCCTCACCGAACTTAACACCGTTTCTGGCTAGAAGCTCAGGGAATA
CACATCCTAGAGCTCCAAGCATAGCCCACCTGCAGTGGATCACTTCAAGTTCACGGTTCTTAGCAAAGTCACCAGGGAATTCACCCGTAAGGTAGCTTGG
GGCCTCACCAGAGAATGGGCCTAAGTACTTGACACGGTCTGGGCCGTACCATGGGCTTCCAGATGCAACCTGCTTGACTGTAGCCTTCCTCATGGAAATG
CGACCGTTTCCAGAAAGCTCAGAACCGGATGGAGCTGCTTTCACAGCCTGTCCGGAG