Detailed information on CNT3019912


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 1e-133

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30500348Citrullus lanatusCoffea canephora50.0355.5582.78836forward
CNT30274489Citrullus lanatusChenopodium quinoa55.0675.1684.24920forward
CNT30526024Citrullus lanatusPhaseolus vulgaris54.4668.7885.49910forward
CNT30630785Citrullus lanatusVigna unguiculata40.6379.686.3679forward
CNT3044330Citrullus lanatusPrunus dulcis54.7674.8284.04915forward
CNT30157648Citrullus lanatusPistacia vera54.767.1683.26914forward
CNT30636316Citrullus lanatusCapsicum annuum54.7644.1483.61915forward
CNT3096790Citrullus lanatusSolanum tuberosum47.0487.5385.75786forward
CNT3089455Citrullus lanatusVigna radiata54.174.3483.3904forward
CNT30147198Citrullus lanatusMedicago truncatula54.5264.5682.44911forward
CNT30652253Citrullus lanatusRosa chinensis55.1270.9683.6921forward
CNT30716337Citrullus lanatusMalus domestica golden54.773.7785.23914forward
CNT30622816Citrullus lanatusDaucus carota51.7145.9684.49864forward
CNT30359535Citrullus lanatusLactuca sativa54.4653.8884.07910forward
CNT30418079Citrullus lanatusPapaver somniferum52.7868.1682.43882forward
CNT30704859Citrullus lanatusPrunus avium54.8875.8584.51917forward
CNT30643414Citrullus lanatusCannabis sativa52.7283.7582.97881forward
CNT3026527Citrullus lanatusPopulus trichocarpa53.9292.2282.8901forward
CNT30174705Citrullus lanatusVigna angularis54.5258.8984.96911forward
CNT30334114Citrullus lanatusCynara cardunculus54.5839.9882.02912forward
CNT30726149Citrullus lanatusLupinus angustifolius54.74883.37914forward
CNT3051100Citrullus lanatusCucumis sativus54.8264.4684.83916forward
CNT30114619Citrullus lanatusEutrema salsugineum54.6484.4682.37913forward

Expression of CNT3019912

Peptides detected in this lncRNA

>peptide 1 (79 aa)
MKSGFLLNVVIGKGSPIFQLLSGKYQSLLVWGDTFLILDLGLHVINSVGRLHLKGDGLSGKGLDEDLHATTEPEHEVKS*

>peptide 2 (32 aa)
MAANKATHTCQVFPFPEEKFRNHHGDEGQGEG*

>peptide 3 (31 aa)
MVSELSTSRVMVFPVRVFTKICMPPRRRRTR*

>peptide 4 (47 aa)
NSDYLCRPFSISKHEEKTECYCNYLITILREVLPIYLSEPTSIIHII*

>peptide 5 (41 aa)
MVSEDSTSRVMVLPVRVLTKICIYTERNRDIRFSIPSQQTG*

Sequence

>CNT3019912
AAATTCCGATTATTTGTGTCGTCCATTCTCAATTTCCAAACACGAAGAGAAAACGGAATGTTACTGTAACTATTTAATTACCATTCTCAGAGAAGTACTT
CCAATTTATTTATCTGAACCCACTAGTATTATACATATCATATAGAATACTGTTCTCCCTAAATTGCGAACTTGAGAGAACATTTAGAAACAACATACTT
GAAAAGCAAAAGAAACAGAAGTATCCCAAACTCATTCCCATGGCCGCAAACAAGGCCACCCACACATGCCAAGTTTTCCCATTTCCAGAAGAAAAGTTCA
GAAACCACCACGGAGACGAAGGACAAGGTGAAGGGTAGACTCCTTCTGAATGTTGTAATCAGCAAGGGTCCTTCCATCTTCTAGTTGCTTTCCAGCAAAG
ATCAACCTCTGCTGGTCCGGAGGAATTCCCTCCTTGTCCTGAATTTTTGCCTTCACATTGTCGATTGTATCAGAACTCTCCACCTCCAAAGTGATGGTCT
TCCCCGTCAGGGTCTTAACAAAGATCTGCATTCCTCCCCTCAGACGAAGGACAAGGTGAAGAGTTGACTCCTTCTGAATGTTGTAGTCAGCAAGAGTCCT
TCCATCCTCAAGCTGCTTTCCGGCAAAGATCAACCTCTGCTGGTCTGGGGGGATGCCTTCCTTATCCTGAATTTTCGCCTTAACATTGTCGATGGTATCG
GAACTCTCGACCTCAAGGGTGATGGTCTTTCCGGTGAGAGTTTTCACAAAAATTTGCATGCCACCGCGGAGACGGAGGACAAGATGAAGAGTGGATTCCT
TCTGAATGTTGTAATCGGCAAGGGTTCGCCCATCTTCCAACTGCTTTCCGGCAAATATCAATCTCTGCTGGTCTGGGGGGATACCTTCCTTATCCTGGAT
CTTGGCCTTCACGTTATCAATAGTGTCGGACGACTCCACCTCAAGGGTGATGGTCTTTCCGGTAAGGGTCTTGACGAAGATTTGCATGCCACCACGGAGC
CGGAGCACGAGGTGAAGAGTTGATTCTTTCTGGATGTTGTAGTCGGCAAGAGTTCGGCCATCCTCAAGTTGCTTGCCGGCGAAGATCAAACGTTGCTGAT
CCGGGGGGATTCCTTCCTTATCCTGGATCTTGGCCTTAACGTTGTCGATGGTGTCAGAGGACTCCACCTCGAGGGTGATGGTCTTGCCTGTGAGGGTTTT
AACGAAGATTTGCATCTATACAGAACGAAACAGAGATATCAGATTCTCAATTCCATCTCAACAAACTGGGTAAACAGATCAGAATTACATAGTTTAAACC
TAAATTCTATTTCTTTAAATCAGAATCGTACTGTTGAAAACCTAATTGAAGATTTCATACCATCAGAAAAATCCCAATTTTCCAGGCAACCACGTAAAAA
CTTAGCAAAACCCAGAGATATGACAACAATCATAAACTTTAATTCGATCAAAGAGCAGATCTAGCCACAAAATCTCAAGTACCCTACAAGGATGCTCAGT
TCTATAATTCACACAACTGAGAGCATCTCAAACGGAATTCTCTATTCAAAATCCTAAACATTTCATCTCTCAAGGCCAAACAACATGATCAAACAAGAAA
TGAAAGCAGAAAAATAAAATACCTTGAAGAAATTGGTTGGTTTGCTACGATGGAGAAGAGGAGAGAAATTC