Detailed information on CNT3019808


BLAST search results

BLAST vs Swiss-Prot:
sp|P36181|HSP80_SOLLC, E-value = 6e-103

BLAST vs NONCODE:
NONMEST000006, E-value = 1e-127

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695408Citrullus lanatusOryza sativa17.7629.6883.19119forward
CNT30675624Citrullus lanatusSetaria viridis29.8531.788.5200forward
CNT30523296Citrullus lanatusSetaria italica18.8126.2581.75126forward
CNT30729348Citrullus lanatusCorchorus capsularis37.9128.0781.1254forward
CNT30379140Citrullus lanatusManihot esculenta42.6934.0186.36286forward
CNT30526134Citrullus lanatusPhaseolus vulgaris42.3944.5887.32284forward
CNT30630919Citrullus lanatusVigna unguiculata42.3921.3287.32284forward
CNT30712340Citrullus lanatusGlycine max21.7925.3986.3146forward
CNT30636154Citrullus lanatusCapsicum annuum20.4529.6586.13137forward
CNT3094731Citrullus lanatusSolanum tuberosum42.5418.9987.37285forward
CNT30187977Citrullus lanatusSecale cereale4037.1286.57268forward
CNT30394033Citrullus lanatusTriticum turgidum4019.8186.94268forward
CNT30566784Citrullus lanatusActinidia chinensis41.0436.1886.91275forward
CNT30510227Citrullus lanatusSolanum lycopersicum42.5424.3488.07285forward
CNT30554909Citrullus lanatusOryza glaberrima17.0129.6182.46114forward
CNT30145670Citrullus lanatusMedicago truncatula27.4645.2184.24184forward
CNT30314068Citrullus lanatusCamelina sativa38.3616.9585.6257forward
CNT3082269Citrullus lanatusBrassica juncea21.7922.5388.36146forward
CNT30606420Citrullus lanatusGossypium raimondii34.6340.6388.36232forward
CNT30652959Citrullus lanatusRosa chinensis21.7930.3581.51146forward
CNT30204348Citrullus lanatusHelianthus annuus14.9331.4584100forward
CNT30625276Citrullus lanatusDaucus carota41.9419.9986.48281forward
CNT30688537Citrullus lanatusTriticum urartu11.3432.989.4776forward
CNT30477326Citrullus lanatusArabidopsis halleri38.2128.9683.2256forward
CNT30362691Citrullus lanatusSorghum bicolor28.9619.6285.05194forward
CNT30154320Citrullus lanatusPrunus persica17.7632.2584.03119forward
CNT30704690Citrullus lanatusPrunus avium41.4913.6887.41278forward
CNT30318584Citrullus lanatusAsparagus officinalis37.9120.9288.58254forward
CNT30558289Citrullus lanatusPanicum hallii26.7230.4979.89179forward
CNT30551470Citrullus lanatusOryza brachyantha38.8159.7785.38260forward
CNT30113681Citrullus lanatusFicus carica38.3635.381.71257forward

Expression of CNT3019808

Peptides detected in this lncRNA

>peptide 1 (45 aa)
GINSSQLSMMKTRRTYNLMLFGFFFVSKRSKGALLGTKRIALNSN*

>peptide 2 (55 aa)
RNQFLTVVHDEDAANIQLNVVRLLLCVEEIKRSPLGNKEDSLEFQLTFNREVLYG*

>peptide 3 (34 aa)
MLLPVVGKALVESSILFLRNLFWLPHPDRLLFVH*

Sequence

>CNT3019808
CAGGAATCAATTCCTCACAGTTGTCCATGATGAAGACGCGGCGAACATACAACTTAATGTTGTTCGGCTTCTTCTTTGTGTCGAAGAGATCAAAAGGAGC
CCTCTTGGGAACAAAGAGGATAGCCTTGAATTCCAATTGACCTTCAACAGAGAAGTGCTTTACGGCTAGATGCTCCTCCCAGTCGTTGGTAAGGCTCTTG
TAGAAAGCAGCATACTCTTCCTTCGTAATCTCTTCTGGCTTCCTCATCCAGATAGGCTTCTGTTTGTTCACTAACGACCACTCATGTGAAACTTCCTTGA
TCTTCTTCTTTTTCTTTTCTTCCTTCTCCTTCTCTTCATCAACTTCCTCAACCTTTCCTTCCTCGTCCTTCTTCTCTTCCTCATCTTCATCATCAGAGAT
TTCCTTCTCAATGGTCTTCTCAACCCAGAGAGAGATTGGGTAGCTAATAAACTCAGAGTGCTTCTTGATCAAGTCCTTGAGACGACGCTCCTCAAGGTAT
TCAAGCTGATCTTCCTTGAGACGACGCTCCTCAAGGTATTCAAGCTGATCTTCCTTGAGGTACAGGGTAATCTTAGTACCTCGGCCAAGATTCTCACCAG
ATGTGTCCCTGGTGACTGTGAACGAACCCCCAGCTTGGGACTCCCAAACATACTGCTCATCATCATTGTG