Detailed information on CNT3019668


BLAST search results

BLAST vs Swiss-Prot:
sp|P81531|CYPH_BETPN, E-value = 2e-13

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30702610Citrullus lanatusQuercus lobata28.7723.3786.07122forward
CNT3071229Citrullus lanatusQuercus suber27.3615.7286.21116forward
CNT30632225Citrullus lanatusVigna unguiculata2521.8686.79106forward
CNT30507180Citrullus lanatusNicotiana attenuata21.713.5786.9692forward
CNT30710754Citrullus lanatusGlycine max26.6543.4685.84113forward
CNT3043301Citrullus lanatusPrunus dulcis20.5212.291.9587forward
CNT30167177Citrullus lanatusPistacia vera28.7717.0989.34122forward
CNT30638631Citrullus lanatusCapsicum annuum21.712.285.8792forward
CNT3090362Citrullus lanatusSolanum tuberosum28.0724.9585.71119forward
CNT3084160Citrullus lanatusVigna radiata20.9910.3688.7689forward
CNT30312502Citrullus lanatusCamelina sativa25.2430.2385.05107forward
CNT30653963Citrullus lanatusRosa chinensis25.9413.2288.18110forward
CNT30624974Citrullus lanatusDaucus carota20.2811.8183.7286forward
CNT30155236Citrullus lanatusPrunus persica20.289.6890.786forward
CNT30430189Citrullus lanatusPapaver somniferum25.2410.482.24107forward
CNT30706413Citrullus lanatusPrunus avium20.5226.3693.187forward
CNT3022997Citrullus lanatusPopulus trichocarpa25.9420.8384.55110forward
CNT3035490Citrullus lanatusCucumis melo22.4119.3192.6395forward
CNT30175854Citrullus lanatusVigna angularis20.7526.3586.3688forward
CNT30724737Citrullus lanatusLupinus angustifolius21.713.6191.392forward
CNT3051249Citrullus lanatusCucumis sativus40.5769.9287.21172forward

Expression of CNT3019668

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MIIDTISPEQMTAVELASTNLRELATIRNNNRSSIRHG*

>peptide 2 (44 aa)
DTAILLKVLGLNNQLCLGKTTAKPPFNRKVKGQLHIISRSSTNP*

Sequence

>CNT3019668
GACACAGCCATATTATTGAAGGTCCTCGGTTTGAACAACCAATTATGTCTAGGAAAAACCACCGCAAAACCGCCATTTAACAGAAAGGTAAAAGGGCAGC
TGCACATAATCTCAAGAAGTAGCACAAACCCATGACCCATAGTCCTAAATAGGAGACTCACAAAGACCCATATTCGCAGCAAGTTAAAACAACACACGCA
AATAGGAAATGATCATAGATACGATTTCGCCGGAGCAGATGACGGCGGTAGAGCTAGCATCCACCAATCTAAGAGAGCTGGCCACAATCAGAAACAACAA
CCGGTCCAGCATTCGCCATGGATAGAATACCAGGTCCGGTGTGCTTCTTGATGAAGTTCTCGTCGGCGAACTTAGCGCCGTAGATCGATTCACCTCCTGT
ACCATTTCCGGCTGTGAAATCGCC