Detailed information on CNT3017870


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9CAD5|YODA_ARATH, E-value = 7e-07

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676610Zea maysSetaria viridis99.5179.3390.57403forward
CNT30524121Zea maysSetaria italica55.836.4590.71226forward
CNT30132936Zea maysLolium perenne33.8312.3482.48137forward
CNT30339804Zea maysEragrostis tef70.8627.6282.58287forward
CNT30366015Zea maysSorghum bicolor44.4453.8993.89180forward
CNT30603977Zea maysOryza punctata37.2837.5680.13151forward
CNT30558445Zea maysPanicum hallii59.5140.7889.63241forward

Expression of CNT3017870

Peptides detected in this lncRNA

>peptide 1 (63 aa)
MQEEVGRNWETKEEASKNCGLEEEVSKHQKLDEEASMHQKLEEEARDVVGSSNHPSFLLVTSG*

Sequence

>CNT3017870
GTTAAATCCAAGGTAAACCTGACCAAATGTACCACTCCCTAGCAATTTCCCTTTCTTCCATTGTGACTGGGACTGTGAGCAGTTAGTGGGAGATGCAGGA
AGAGGTGGGCAGGAACTGGGAGACGAAGGAAGAGGCGAGCAAAAACTGTGGGTTGGAAGAAGAGGTGAGCAAGCACCAGAAGCTGGATGAAGAGGCGAGC
ATGCACCAGAAGCTGGAGGAAGAGGCAAGGGATGTGGTGGGCTCCTCAAACCATCCATCTTTCTTACTGGTGACCTCGGGCTGAAACCAAATTCTCTAGA
ATTTCCATTGCTCACAGCGAATGCATGGCCTTTTGGGATAGGAGAGAGACTCCTTGTTCTTGGAGCAAAAAGATCTCCAGATATCATTCTTCCACGTGAA
CAATT