Detailed information on CNT3017794


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676764Zea maysSetaria viridis7.5734.1583.6798forward
CNT30523744Zea maysSetaria italica8.9631.5291.38116forward
CNT30464095Zea maysSaccharum spontaneum70.7933.8484.5916forward
CNT30151430Zea maysBrachypodium distachyon4.3324.1492.8656forward

Expression of CNT3017794

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MTKQKNFQNTRKEHEAKTDKEIRFFCNASV*

>peptide 2 (58 aa)
MPQISFDCRTPSRFSLESSDLELTLHQVIAFLSGEPEDWGEEPVAATGASWEQHPPGP*

>peptide 3 (54 aa)
MVVVVVLLGLWLPEQLAHVERVLPIGIVLGLDVLDLVPEGRGVEVEGSAVGSADV

>peptide 4 (40 aa)
MNNNTQLPKHTKSVIKEQFSNRIMHATNQDKTLGLIYKHQ*

Sequence

>CNT3017794
GGTGCACAAAAAAATGAATTCCAGGTTCATCAATCAATATTTAAATTGCACGATGCATAGTCAAGACAAAAAATAACTACGATTCCACGAAACTTCAACT
GAAAGAGAGAAATAGAACATAACAATAAAGCAGCACTACAATCTCAGTCTCTGTATTCATGTCACATTCGATGCTGTTTCTCCAAGTAGGTTCTGCCTAA
AACAGGGACTTGGATACATAGCACATCCATTTTGCAGACAGAAACATCACTGAAAGACAACTGCTTGGATCGTTATATGACATCAACCAAGCTTTACGAT
TCTTTATGACCAAGCAGAAAAACTTTCAGAATACAAGGAAAGAGCACGAAGCAAAAACTGACAAGGAAATAAGGTTCTTCTGTAATGCCTCAGTTTAATC
AGATGATGTCATATTATGTACCATGTTTCCTCGAGTAGGTTCTCCCTGAAACAGGGGACTTGAGTCCACAGGACATCCATTTTGCAGACAAATCATCACT
GGCAGTGCCACAAAGTAATTTGTTTTGCTGATAAAACACTAGACACAAGAAAAGGCATAAACATCTCAACAACAAATAATCATTACATGAACAATAACAC
ACAGCTACCTAAGCATACTAAATCAGTCATCAAAGAACAATTCTCAAACAGAATAATGCATGCAACAAACCAAGACAAAACATTAGGCCTTATTTATAAA
CATCAGTAAATGCCCAGGTATCTCATTTGAATGTAGGACCCCAAGTAGGTTCTCCCTGAAACAGGGCTTGGAGTTACCTACACCTCACATGTTGGGACAA
CTCGTCATTGGCTACTGTGATGGTGAAAATTGAAGGCGTCCAAGTTTCACAATCTTTCAAATGTAACAGTGAAAGATAAGAAAGAGCTGAACATAACATC
AGCGAAAATTTAAACAAGAACTACAGTGCACGCAAAAAATACATATCAGAAAATGCCTCAGATCTCATTTGATTGTAGGACTCCAAGTAGGTTCTCCCTG
GAGAGCAGCGACTTGGAGCTTACCCTACATCAAGTGATAGCCTTCTTATCGGGTGAACCAGAAGACTGGGGAGAAGAACCAGTCGCCGCAACTGGTGCGT
CGTGGGAGCAGCACCCACCGGGGCCGTGATGGTGGTGGTGGTGGTGCTTCTTGGGCTGTGGCTGCCGGAGCAGCTTGCGCATGTCGAACGCGTCCTCCCC
ATCGGCATAGTACTTGGCCTCGATGTCCTGGATCTGGTACCCGAGGGTAGAGGTGTAGAGGTTGAAGGCAGCGCGGTTGGATCGGCGGACGTGG