Detailed information on CNT3017683


BLAST search results

BLAST vs Swiss-Prot:
sp|Q84RL6|TIP23_MAIZE, E-value = 4e-26

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30589276Zea maysMusa acuminata12.521.6893.5562forward
CNT30443231Zea maysAegilops tauschii19.1522.1490.5395forward

Expression of CNT3017683

Peptides detected in this lncRNA

>peptide 1 (38 aa)
YGILAPLVNGNENQTLGNANRTKHDHSTKRQMTRRRRW*

>peptide 2 (61 aa)
MLAPTMKPMAMGAMVPRDPFFGSAAVITISITTPSISLIPETPCVGIACTAHSSFVKLHFT*

Sequence

>CNT3017683
TACGGCATCTTGGCACCGTTGGTGAATGGAAATGAAAACCAGACGTTGGGAAATGCAAACAGGACAAAACATGATCACAGCACGAAGCGCCAGATGACAC
GACGACGACGATGGTGAAATCAACACAGACGGATCGATCGGGCTAGCTCATCCGGACTTTCATGGGTACTCCTGCTGGCCGACCGGCTGGTAGGAGGGGC
CGGCGGCCAGGATGTTGGCGCCGACGATGAAGCCGATGGCCATGGGCGCGATGGTGCCCAGGGACCCCTTCTTCGGGTCGGCCGCGGTGATCACGATCTC
CATCACCACGCCCTCGATCTCGCTGATCCCGGAGACGCCGTGCGTCGGGATAGCCTGCACAGCACACAGTTCGTTCGTTAAGCTCCACTTTACTTAATCC
GCCTTCTCTCTTCTCTTCCGGGAGCTGAGCTGAGGAGGTGCGCAGTGAAAGAAAAAATACACAGCTGCTACGGTAACGCGCCAAGACTGGTCGAGC