Detailed information on CNT3017602


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676060Zea maysSetaria viridis16.2230.2298.18110forward
CNT30524028Zea maysSetaria italica26.9923.9295.08183forward
CNT30681224Zea maysTriticum urartu10.4721.2698.5971forward
CNT30344698Zea maysEragrostis tef16.2222.9694.55110forward
CNT30366281Zea maysSorghum bicolor17.1125.1687.07116forward

Expression of CNT3017602

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MPSFSVAIVSADALTAANRRLPDALGKEKEQKLRRPV

Sequence

>CNT3017602
TCCTCTAAAACTGTTCCATAGTTTTATTTGTATTAAAACTGATCAGCTGGAATAGTTTCAGGTCTTATCACAGCTAACCGAACGGGATCTGAAACAGATA
GTACAGCATTGTAGTCCCCTAATCCGGAGCTTTATTACACGGTCTGTTAACTCTGGAGTGGAGCATCATAGGTTCAGAGTACAAGAGCACAGCAAGTCTA
CATCGAGCGCCGCAGGGCTAGTCGGCGGCGGCGGCTACTCGAAGTTGTAGTGCTTGTCGACGGCCTCGGCGACGTCCCAGGTGCAGCTCATGCCCTTGGG
GAAGACGACAAGGTAGCACGTCTCCTTGGCGGAGTAGGTCCACGGGAACTTGCTCTTCTCGCACCCCCACCTGATCGGTCCATTCATTCATCAGCAGGCC
GCAGTCAGCACGGGCACGGAGCGGGCGGAGGGCGGCGGGGAGATTCGAGATCGAGACGCCGGCTGGGAGGGAGGGAGGGCGGCTCGCACGCTCGCTCACT
TACTTGGGCCACTGGCGGACGCCGAGCTCGGAGAGACGGGACTCGGGCGGGTTGCGCTCCACCTTGATGCCCAGCTTCTCCGTCGCCATCGTCTCCGCGG
ACGCCCTCACCGCCGCGAATCGCCGCCTCCCTGATGCGCTGGGAAAGGAAAAGGAGCAGAAGCTGAGGCGGCCGGTTG