Detailed information on CNT3017355


BLAST search results

BLAST vs Swiss-Prot:
sp|P31156|METK2_PETCR, E-value = 4e-61

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672906Zea maysSetaria viridis58.337.2187.93323forward
CNT30349160Zea maysEragrostis tef46.9328.0586.15260forward
CNT3055147Zea maysAmborella trichopoda24.9114.2682.61138forward
CNT30101810Zea maysOryza rufipogon58.312.7485.45323forward

Expression of CNT3017355

Peptides detected in this lncRNA

>peptide 1 (51 aa)
MIERRHTRPDQTRPKASSKTEEAPHAEDGFSALRGFTTSQVKSGSSLPKCP*

>peptide 2 (42 aa)
MMIMPGLKSKFSFTIFRISLSGIAPVPYVSTNTERGSGTPMA*

Sequence

>CNT3017355
CAAAACCAGAAATAATCCTCTAGTAGGTGAATAAGCAGACACAATACGACCCCGCACACGTACCACTTATTAGGACAGTGACAGTACAGTACAAATGATA
AGCAAGGGGCAGATCAAGAATCACAAGTAGGAGCCATAAAAAAGCATGATAGAGCGCAGGCACACCAGACCAGACCAGACCAGACCAAAAGCTTCTTCCA
AAACAGAGGAGGCGCCTCATGCAGAAGACGGCTTCTCCGCCTTGAGGGGCTTCACCACCTCCCAGGTGAAGTCGGGGTCGTCCCTCCCAAAGTGCCCGTA
GGCCGCCGTCTTGAGGTAGCGCCCGTTGATGATGATCATGCCGGGCCTGAAGTCGAAGTTCTCCTTCACGATCTTCAGGATCTCCTTGTCGGGGATCGCG
CCGGTGCCGTACGTGTCCACGAACACCGAAAGGGGCTCGGGCACGCCGATGGCGTAGGAGACCTGGACAATGGCGCGGCGGGCGAGGCCGGCGGCGACGA
TGCTCTTGGCAGCCTGCCTCGCGACGTAGGCCCCGCTGCGGTCCACCTTGGTCG