Detailed information on CNT3017254


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONZMAT001339, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3017254

Peptides detected in this lncRNA

>peptide 1 (68 aa)
MNGAKRSAEAVGCQNASVGERSALEGSKRESGGRRSGSENVGLSNENIGENPMPRKPKVSSARFVHGG*

>peptide 2 (38 aa)
MSRRLIGSGLVKGMEPTEAVAKASLHRAIVTAYGPEPG*

>peptide 3 (48 aa)
MGDKLHRREGNNPDHQLRPLNDRSVIKEVGVQRQPGGLPRSSHPLKSA*

>peptide 4 (59 aa)
MPLEPRASWFSPKCIEAQQLTGYLGVKHCFGAGCASGTKSRQTLNTRYDPKITGVKVGQ*

>peptide 5 (29 aa)
MGHVESRVNQQGPPCKAKYSWVTDSEVVP*

>peptide 6 (35 aa)
MPRAEVRVPSAAALKYEPRGLAIASPRGSYQALRR*

>peptide 7 (32 aa)
MSKCIGRGAFRLRGKQTRKRGSTKRKRECRLE*

Sequence

>CNT3017254
GTAGCATGGGTAGGCCTAAACCGTGAAAACGGGGTTGTGGGAGAGCAATACAAGCGTTGTGCTGCTAGGCGAAGCGGTTGAGTGCCGCACCCTAGATGGC
TAAAGTCCAGTAGCCGAAAGCATCACTAGCTTACGCTCTGACCCGAGTAGCATGGGGCACGTGGAATCCCGTGTGAATCAGCAAGGACCACCTTGCAAGG
CTAAATACTCCTGGGTGACCGATAGTGAAGTAGTACCGTGAGGGAAAGGTGAAAAGAACCCCCAGTGGGTAGTGAAATAGAACGTGAAACCGTGCTGAGC
TCCCAAGCAGTGGAGGGGAAAGTGATCTCTGACCGCGTGCCTGTTGAAGAATGAGCCGGCGACTCATAGGCAGTGGCTTGGTTAAGGGAATGGAACCCAC
CGAAGCCGTAGCGAAAGCGAGTCTTCATAGGGCGATTGTCACTGCTTATGGACCCGAACCTGGGTGATCTATCCATGACCAGGATGAAGCTTGGATGAAA
CTAAGCAGAGGTCCGAACCGACTGATGTTGAAGAATCAGCGGATGAGTTGTGGTTAGGGGTGAAATGCCACTCGAACCCAGAGCTAGCTGGTTCTCCCCA
AAATGCATTGAGGCGCAGCAGTTGACTGGATATCTAGGGGTAAAGCACTGTTTCGGTGCGGGCTGCGCGAGCGGTACCAAATCGAGGCAAACTCTGAATA
CTAGATATGACCCAAAAATAACAGGGGTCAAGGTCGGCCAGTGAGACGATGGGGGATAAGCTTCATCGTCGAGAGGGAAACAACCCGGATCACCAGCTAA
GGCCCCTAAATGACCGCTCAGTGATAAAGGAGGTGGGGGTGCAAAGACAGCCAGGAGGTTTGCCTAGAAGCAGCCACCCTTTAAAGAGTGCGTAATAGCT
CACTGATCGAGCGCCCTTGCGCTGAAGATGAACGGGGCTAAGCGATCTGCCGAAGCTGTGGGATGTCAAAATGCATCGGTAGGGGAGCGTTCCGCCTTAG
AGGGAAGCAAACGCGAAAGCGGGGGTCGACGAAGCGGAAGCGAGAATGTCGGCTTGAGTAACGAAAACATTGGTGAGAATCCAATGCCCCGAAAACCCAA
GGTTTCCTCCGCAAGGTTCGTCCACGGAGGGTGAGTCAGGGCCTAAGATCAGGCCGAAAGGAGTAGTCGATGGACAACAGGTCAATATTCCTGTACTACC
CCTTGTTGGTACGGAGGGACGGAGGAGGCTAGGTTAGCCGAAAGATGGTTATAGGTTTAAGGACACAAGGTGACCCTGCTTTTTCAGGGTAAGAAGGGGT
AGAGAAAATGCCTCGAGCCGAGGTCCGAGTACCAAGCGCTGCAGCGCTGAAGTATGAGCCCCGTGGACTAGCCATTGCTTCTCCACGAGGCTCATACCAG
GCGCTACGGCGCTGAAGTATGTAACCCATGCCATACTCCCAGGAAGAGCTCGAACGACCTTCAACAAAAGGGTACCTGTACCCGAAACCGACACAGGTGG
GTAGGTAGAGAATACCTAGGGGAGCGAGACAACTCTCTCTAAGGAACTCGGCAAAATAGCCCCGTAACTTCGGGAGAAGGGGTGCCCCCTCGCAAAAGGG
GGTCGCAGTGACCAGGCCCGGGCGACTGTTTACCAAAAACACAGGTCTCCGCAAAGTCGTAAGACCATGTATGGGGGCTGACGCCTGCCCAG