Detailed information on CNT3016707


BLAST search results

BLAST vs Swiss-Prot:
sp|O22348|TBA2_ELEIN, E-value = 4e-44

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30677660Zea maysSetaria viridis44.559.7394.76267forward
CNT30522342Zea maysSetaria italica54.555.6194.5327forward
CNT30297029Zea maysTriticum aestivum18.3343.1488.18110forward
CNT3059767Zea maysArabidopsis lyrata27.1722.9987.12163forward
CNT30446069Zea maysSaccharum spontaneum65.6717.3794.92394forward
CNT30344814Zea maysEragrostis tef36.1754.5287.56217forward
CNT30361568Zea maysSorghum bicolor71.562.0895.1429forward
CNT30358630Zea maysLactuca sativa41.3363.2781.05248forward
CNT3022486Zea maysPopulus trichocarpa262586.54156forward
CNT30333509Zea maysCynara cardunculus32.3335.2784.02194forward

Expression of CNT3016707

Peptides detected in this lncRNA

>peptide 1 (74 aa)
TAIKLGRGRCRTWDLLRQYPISGSGRLPRLRLSTLQSSIATPHSPMASAVCAESAARARHSPRHSLRSLAGVMQ*

>peptide 2 (49 aa)
MNECTFGIHEIKLAVNTREDLSHGCVVADHADCSLHLGQVPSRDYSWWLV

>peptide 3 (38 aa)
PLSSWAVGDVERGTYYVSIRSPAPAGYLVYGSPPSNPP*

>peptide 4 (41 aa)
MRSNLRSIREKTSATAVLLLIMQTARCTLARSPPGTTVGGW*

Sequence

>CNT3016707
ACCGCTATCAAGTTGGGCCGTGGGAGATGTAGAACGTGGGACCTACTACGTCAGTATCCGATCTCCGGCTCCGGCCGGCTACCTCGTCTACGGCTCTCCA
CCCTCCAATCCTCCATAGCCACCCCTCATTCTCCGATGGCATCAGCCGTCTGCGCCGAATCGGCAGCTCGAGCTCGGCATTCTCCTCGCCACAGCCTCCG
TTCACTAGCAGGTGTAATGCAATAGCAAACATGGAATAAATGGGAGGTACAACCATGCAACTCAAGCACGCCTGGTTGACTGACACCAAAGGAAAATAAC
CATGCATCCAGATCGATGACTCAATACTCAGCTTCCTCGTCCTCATCTTCAACTTCAGCTCCGACTTCCTCATAATCCTTCTCCAGTGCTGCAAGATCCT
CCCTTGCCTCTGAGAACTCCCCTTCTTCCATCCCTTCACCGACATACCAATGAACGAATGCACGTTTGGCATACATGAGATCAAACTTGCGGTCAATACG
AGAGAAGACCTCAGCCACGGCTGTGTTGTTGCTGATCATGCAGACTGCTCGTTGCACCTTGGCCAGGTCCCCTCCAGGGACTACAGTTGGTGGTTGGTAG