Detailed information on CNT3016501


BLAST search results

BLAST vs Swiss-Prot:
sp|F4JY11|CAND7_ARATH, E-value = 7e-87

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30640854Zea maysNymphaea colorata33.7426.7186.67195forward
CNT30377431Zea maysArabidopsis thaliana42.9113.1179.44248forward
CNT30590382Zea maysMusa acuminata14.7139.5384.7185forward
CNT30480507Zea maysArabidopsis halleri14.3639.985.5483forward
CNT30368666Zea maysSorghum bicolor37.0245.0597.2214forward

Expression of CNT3016501

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MRFTAAFPSERAASRRFLMDHTIGKSTAQQQITSTSKKICFQVTQSRA*

Sequence

>CNT3016501
AAGACATAGAACGCGAGCGTCGCGAGCTCCCCGGCCACGACGCTAGTCCACAGGTACCGGTATGAGGTGATGGTCTGTAGCGCATACACCACAACACGCG
TGAAGTAAATGTAGCAGATGACGACCACATAGTACTGGCGGAAGAGGGTGAGCTTCATGAGGTTCACAGCGGCCTTCCCATCCGAGCGAGCAGCCTCCCG
GAGGTTCTTGATGGACCACACAATCGGGAAGAGCACAGCACAGCAGCAGATCACATCAACCAGCAAGAAAATCTGCTTCCAGGTGACCCAGTCCCGAGCA
TAGGGTCCAGATTCGTCAATCACCACCTGCGCGATGTTGGCTACGACCTGCAGGGGGATGACCGCCATAAGCACCTTCTTCTCTCGGTCGGCCAGGTAGG
GCTTGAGGAAAGACCAGCCGGTGCCGATGAGCACTATGAGCGTGAAGAGCGAGATCCCCTTGAGGAAGCTGAAGATGTAGAAGAGCACGTCCCATCCGTG
GGTCGTGCCGGTGCGCTCGATGCATGACTTGTCCTCGGCCTCGGCGAGGAGGTTGAGAGCCTTGAGCACGAGCACGGC