Detailed information on CNT3016498


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30548701Zea maysIpomoea triloba34.965.6994.3158forward
CNT3020893Zea maysCitrullus lanatus21.245.7695.8396forward
CNT30553404Zea maysOryza glaberrima35.1811.26100159reverse complement
CNT30595548Zea maysOryza meridionalis36.9568.7288.62167forward
CNT30415137Zea maysPapaver somniferum20.357.192.3992reverse complement
CNT30574571Zea maysVitis vinifera32.32.3795.21146forward
CNT3054921Zea maysAmborella trichopoda32.9642.4595.3149forward
CNT30577864Zea maysOryza barthii53.9843.7392.21244reverse complement

Expression of CNT3016498

Peptides detected in this lncRNA

>peptide 1 (48 aa)
WNKKGRRTISISAITKKKEASSLSLFVFPLPEQTLRKIILSPGPVFPH*

>peptide 2 (36 aa)
LEQEGSSYNFHFGDYKKEGGELPIPLCLSTSGTNTS*

>peptide 3 (39 aa)
GTRRVVVQFPFRRLQKRRRRAPYPSLSFHFRNKHFVKLF*

Sequence

>CNT3016498
CTGGAACAAGAAGGGTCGTCGTACAATTTCCATTTCGGCGATTACAAAAAAGAAGGAGGCGAGCTCCCTATCCCTCTTTGTCTTTCCACTTCCGGAACAA
ACACTTCGTAAAATTATTTTGAGTCCCGGCCCGGTTTTTCCCCACTAACCAATTACGTTACGACCACTGAACAAACTTGGTTGACGAACATGGTTTATGC
GCCGCTAATCTAGCGGCTTGTCGAGCATTTGACAAACTCACACCATCCATTTCAAATGGGATTTGTCCCGTGGACACACGAGCAATCCAACCCCTAGGAG
CCTCTTTTCCTTCTGCCCAGCTCCCCGAAAACAACGTTCGACTTGCATGTGTTAAGCATATAGCTAGCGTTCCTTCTGAGCCAGGATCAAACTCAGATTT
TGACTATGATTGGGCCGAACAGTGGTAGAACCTGGTGAACCGGGCCTACTAC