Detailed information on CNT3016423


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673627Zea maysSetaria viridis19.2654.289.54239forward
CNT30350538Zea maysEragrostis tef21.1150.4890.08262forward
CNT30583395Zea maysEchinochloa crusgalli25.3829.5587.62315forward

Expression of CNT3016423

Peptides detected in this lncRNA

>peptide 1 (95 aa)
MTSAISSVWGRSGGSSGRLPRSSDSSHSCLLSSGHSRYDPMPRCVVMASITSVCRSDSCRMSSFTRESPNVNTWRRRSRRLPSAMALSPQSHSDL*

>peptide 2 (85 aa)
MPGSPLAKTISSRSRVTLKNGHSLYISLRTWKFLTSLSMANLNAAPTPSHTGRWNLVWVHEKIQGMARRVVMPPPGLLLAGRLPM*

>peptide 3 (37 aa)
MPAAMPFMVRMSVSSRPGGYSLAGFSLTSPAAASQRA*

>peptide 4 (34 aa)
MTCCLPLIRSMYQSTEKRGRSCRAGAPRGRGTRR*

>peptide 5 (54 aa)
MFIITICIICQDFPLGLDNKSEYKEAGNYICIGKTDAASSAFPSKTDKTPPSGS*

>peptide 6 (40 aa)
MVNKSIQWAGILINYYKTACRLYDVYYYNMYNMPRFSTWT*

Sequence

>CNT3016423
TGGCTGAAGTAACACCATGGTAAACAAGTCCATCCAATGGGCTGGGATATTAATTAATTATTACAAAACAGCATGCAGATTGTACGATGTTTATTATTAC
AATATGTATAATATGCCAAGATTTTCCACTTGGACTTGACAACAAGAGTGAATATAAAGAGGCAGGAAATTACATATGCATAGGGAAAACAGACGCTGCC
AGTTCGGCATTTCCATCCAAAACTGACAAAACGCCACCATCCGGAAGCTGATTATTGCGGTGCACTCTGCAGGTGAGTGAAGAGAAGCCGCCTAGCCAGT
GTTCTGCATGCCGGCGGCGATGCCCTTCATGGTGAGGATGAGCGTGTCTTCCAGGCCGGGCGGGTACTCGCTCGCCGGGTTCAGCTTGACCAGTCCGGCG
GCTGCTTCCCAAAGGGCTTGAGTTCTTCCGCCACAAGCAGCTCGTCATACAAGCCGGCAATGCCGGGGTCTCCCTTGGCGAAAACCATCTCCAGCAGGTC
CAGGGTGACCCTGAAGAATGGCCACTCGTTGTACATCTCTTTGAGGACCTGGAAGTTCCTGACGTCCTTGTCGATGGCGAACTTGAATGCGGCGCCGACT
CCCAGCCACACGGGGAGGTGGAACCTGGTCTGGGTCCACGAGAAGATCCAGGGGATGGCGCGCAGGGTCGTGATGCCGCCGCCGGGCCTCCTCTTGGCTG
GCCGGCTGCCGATGTGAGCTTGACGCCGTAGCGCTTGGCCACCTGCGCCATCTCCTCCTGCGCCCTGTACAGCTGCCACGCCGCGGACAGGCGGCCGGCG
TCCTTGCCGGAGTCGGAGTAGCCGACCATGACCTGCTGCTTGCCCTTGATCCGGTCCATGTACCAGTCCACCGAGAAGAGGGGCCGAAGCTGTCGGGCGG
GAGCTCCGCGAGGACGTGGAACGCGCCGATGACGTCGGCGATCTCGTCGGTCTGGGGAAGGTCCGGGGGCAGCAGCGGGCGCTTGCCTCGCAGCTCCGAC
AGCAGCCACTCCTGCCTCTTGTCCTCGGGCCACTCGCGGTACGACCCGATGCCGAGGTGCGTGGTGATGGCGTCGATCACGTCGGTGTGCCGCTCCGACT
CCTGCCGGATGTCCAGCTTCACCAGGGAGAGCCCGAACGTGAACACCTGGCGCAGGAGGTCCAGGAGGCTCCCGTCCGCGATGGCCTTGTCGCCGCAGTC
ACACAGTGATTTGTAGCACAGCTCAAGTGGCTCAAGGAACT