Detailed information on CNT3016391


BLAST search results

BLAST vs Swiss-Prot:
sp|Q01595|CCDP_MAIZE, E-value = 9e-50

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30192172Zea maysSecale cereale27.2518.8784100forward
CNT30256420Zea maysAvena sativa22.0712.0486.4281forward
CNT3067127Zea maysLeersia perrieri26.711.1685.7198forward
CNT30685047Zea maysTriticum urartu26.1618.1586.4696reverse complement
CNT30596933Zea maysOryza meridionalis31.6110.9284.48116forward
CNT30369850Zea maysOryza glumipatula24.811.2886.8191forward
CNT30593752Zea maysEragrostis curvula24.527.5385.5690forward

Expression of CNT3016391

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MMIKSQSESRDRILRGTFLGCWFYLHIQLN*

>peptide 2 (61 aa)
MRLRLRGILRWMPRTLALMAVQRHSAASRSTSPSSSGQHCSCWGRPTLTRSSTLAHTLSFSA

>peptide 3 (71 aa)
MLVLSPYSAQLVGASEVLRANLAAVVEDEVEAKGHIEVDAEDVSLDGGAEAQCGVEVHQPLQQRATLLVLG*

Sequence

>CNT3016391
TGATAATTAAGTATAAAATATAAAAATAGATAAACAGTGATGATGATCAAGTCACAATCAGAATCGCGAGATCGAATATTAAGGGGTACATTCCTTGGAT
GCTGGTTTTATCTCCATATTCAGCTCAATTAGTTGGGGCAAGTGAAGTCCTCCGGGCAAATCTTGCCGCAGTTGTTGAGGATGAGGTTGAGGCTAAGGGG
CATATTGAGGTGGATGCCGAGGACGTTAGCCTTGATGGCGGTGCAGAGGCACAGTGCGGCGTCGAGGTCCACCAGCCCCTCCAGCAGCGGGCAACATTGC
TCGTGCTGGGGTAGACCGACCTTGACGAGGTCCAGCACGTTGGCGCACACCTTGAGCTTTAGTGCGT