Detailed information on CNT30160916


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30160916

Peptides detected in this lncRNA

>peptide 1 (49 aa)
MLTEEREHNPPLAKESLCSCWECAFSSSVIIMSIFYIHSSSIKHNIKSK*

>peptide 2 (28 aa)
MFCHFFFFFFGFCFWGCLVMWKDEAQMVS

>peptide 3 (49 aa)
MMMTTWTSHVTLLYKEPNSFHYSNEVLSRYVSLIFCLFFYFLSFRWRRT*

>peptide 4 (54 aa)
MIRVLPPLKMASVYGVSTIAIVCLMTGVTIYNWEEEAKAGQPLMVDENEMVRRC*

>peptide 5 (56 aa)
MKFLADTFLSFFVYFFIFCHFVGEEHDQGSSSIENGVGIRCLYHCNCLSHDRGYHI*

Sequence

>CNT30160916
AAATGCTAATATAGCTAAAACCTCTGATAAATTTGACAATTATACAATTCATTAAGCCATTACCATTTCTGGAAAAAGTTTCCATTTCTGCAGAAAACTG
CCAGTTCTTGATGATGATGACGACTTGGACTTCCCACGTCACTCTTCTATATAAAGAACCAAATTCATTTCATTACTCAAATGAAGTTCTTAGCCGATAC
GTTTCTCTCATTTTTTGTTTATTTTTTTATTTTCTGTCATTTCGTTGGAGAAGAACATGATCAGGGTTCTTCCTCCATTGAAAATGGCGTCGGTATACGG
TGTCTCTACCATTGCAATTGTCTGTCTCATGACAGGGGTTACCATATATAACTGGGAAGAAGAAGCTAAGGCTGGCCAGCCCTTAATGGTGGATGAGAAT
GAGATGGTAAGAAGATGTTGACAGAAGAGAGAGAGCACAACCCGCCATTGGCTAAAGAAAGTCTTTGCTCTTGTTGGGAGTGTGCTTTCTCTTCTTCTGT
CATCATCATGTCCATCTTCTACATACACTCTTCTTCTATCAAACATAATATCAAGTCAAAGTAATATGTTCAGAGAATATAGATGTTGACTCTCTGAACA
TTATATTTTGTATCCAGTTTTAGCCACTGAAATTAATGGTCCCAATACCCTTTTACAGATAATTTCAGTATGGCTTTGCTCTGATCCTTGCAGCACACAG
AGAGCTTATGTGTTCAGGAGTGTCTGTTTCAAGAAGAATAATTACCATATATAAAAAGCACTAGGGAGAATGTTCTGCCATTTTTTTTTTTTTTTTTTTG
GTTTCTGTTTTTGGGGTTGTTTAGTCATGTGGAAAGATGAAGCTCAAATGGTTAGTCA