Detailed information on CNT30160120


BLAST search results

BLAST vs Swiss-Prot:
sp|P17786|EF1A_SOLLC, E-value = 0.0

BLAST vs NONCODE:
NONMEST004097, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691950Pistacia veraOryza sativa71.256.1987.57885forward
CNT30677701Pistacia veraSetaria viridis54.8799.5688.12682forward
CNT30521010Pistacia veraSetaria italica71.681.6587.53890forward
CNT30639730Pistacia veraNymphaea colorata43.3658.6585.9539forward
CNT30535563Pistacia veraEucalyptus grandis64.2897.9287.48799forward
CNT30316757Pistacia veraCorylus avellana60.7463.0288.74755forward
CNT30546799Pistacia veraIpomoea triloba69.1169.9587.89859forward
CNT30518094Pistacia veraJuglans regia70.894.0287.73880forward
CNT30377782Pistacia veraArabidopsis thaliana54.9567.6286.68683forward
CNT30618377Pistacia veraSesamum indicum30.73102.4185.86382forward
CNT30274113Pistacia veraChenopodium quinoa35.470.5187.27440forward
CNT3021232Pistacia veraCitrullus lanatus67.7468.0185.99842forward
CNT30727590Pistacia veraCorchorus capsularis70.4764.6589.61876forward
CNT30380230Pistacia veraManihot esculenta67.9834.8387.93845forward
CNT30525464Pistacia veraPhaseolus vulgaris46.9103.1983.88583forward
CNT30629544Pistacia veraVigna unguiculata31.6251.9888.3393forward
CNT30194937Pistacia veraPisum sativum70.8888.1985.02881forward
CNT30712097Pistacia veraGlycine max32.9834.3787.56410forward
CNT30287202Pistacia veraTriticum aestivum37.6565.0986.75468forward
CNT30224987Pistacia veraHordeum vulgare23.0997.2988.15287forward
CNT30387246Pistacia veraTriticum turgidum62.8367.8585.66781forward
CNT30564257Pistacia veraActinidia chinensis48.3552.4487.69601forward
CNT3084148Pistacia veraVigna radiata46.6635.686.72580forward
CNT30541587Pistacia veraBrassica napus69.3573.386.54862forward
CNT30234210Pistacia veraBrassica oleracea69.3578.2986.66862forward
CNT30173274Pistacia veraTrifolium pratense67.4262.386.75838forward
CNT30146334Pistacia veraMedicago truncatula52.4565.5985.43652forward
CNT30440878Pistacia veraAegilops tauschii20.1931.9391.63251forward
CNT30246955Pistacia veraAvena sativa71.250.1485.65885forward
CNT30665783Pistacia veraTriticum dicoccoides65.8189.7983.99818forward
CNT30310177Pistacia veraCamelina sativa69.1974.1487.09860forward
CNT3059230Pistacia veraArabidopsis lyrata69.3571.7186.31862forward
CNT3078925Pistacia veraBrassica juncea69.3573.6187.01862forward
CNT30614135Pistacia veraArabis alpina59.9447.7687.38745forward
CNT30598511Pistacia veraFraxinus excelsior38.1372.8187.55474forward
CNT30449495Pistacia veraSaccharum spontaneum71.1272.6486.54884forward
CNT30132437Pistacia veraLolium perenne71.2873.7184.09886forward
CNT3011166Pistacia veraZea mays71.1262.5286.99884forward
CNT30608730Pistacia veraGossypium raimondii36.0474.6787.72448forward
CNT30127375Pistacia veraCorymbia citriodora42.3294.2785.36526forward
CNT30685098Pistacia veraTriticum urartu42.4835.9288.64528forward
CNT30350898Pistacia veraEragrostis tef70.878.9987.84880forward
CNT30480841Pistacia veraArabidopsis halleri31.362.6485.86389forward
CNT30368770Pistacia veraSorghum bicolor54.9595.3987.85683forward
CNT30355521Pistacia veraLactuca sativa57.675.0586.03716forward
CNT30151899Pistacia veraPrunus persica27.1930.6488.76338forward
CNT30427751Pistacia veraPapaver somniferum69.8359.9485.6868forward
CNT30706337Pistacia veraPrunus avium67.1871.6188.02835forward
CNT3052982Pistacia veraAmborella trichopoda23.7322.5589.15295forward
CNT3024428Pistacia veraPopulus trichocarpa49.0779.9585.74610forward
CNT3037774Pistacia veraCucumis melo38.2161.4587.79475forward
CNT30101053Pistacia veraOryza rufipogon26.8740.1989.52334forward
CNT30585575Pistacia veraEchinochloa crusgalli29.3671.4389.86365forward
CNT30496962Pistacia veraDigitaria exilis70.878.2986.82880forward
CNT30116111Pistacia veraOryza nivara26.3937.4989.02328forward
CNT30594443Pistacia veraEragrostis curvula71.7676.8388.23892forward
CNT30603820Pistacia veraOryza punctata71.1281.9387.67884forward
CNT30176122Pistacia veraVigna angularis67.574.1284.39839forward
CNT30113122Pistacia veraFicus carica39.6659.486.82493forward
CNT30724026Pistacia veraLupinus angustifolius67.9858.6887.46845forward
CNT3050294Pistacia veraCucumis sativus41.1983.5286.33512forward

Expression of CNT30160120

Peptides detected in this lncRNA

>peptide 1 (54 aa)
MVHLNGLNFSGQSSGAKCNNHTRLEDTGFHTTHWYSSNTTNLVHILKWKTQGLV*

>peptide 2 (86 aa)
MSLTAKRPRGGYSENVSTTMGLVGTILTNPASPFFKNLGSFSSSLPDRLSILVKISENLTAMWEVWQSSTGAYPLPIWPGWFMMMT*

Sequence

>CNT30160120
AATTAATACAAAATTTCAGGACTCGGGCTCTTACCTCTAACAAAACTAAATAACTCAATTTAGCAATGCAGCATTAGCTATCAAATTGAAACCATGATGT
TTTAACATTTTGGGATTTGGTTCAGTAACACAAGAACTCATTTTAAAGCCTATAAAACCAAATCAAGAAAAGCAAATCCCGACTTCCATCACAACCAGTT
GAGCACCAGATGATATCCAACTGCTCAACTTTAGCGGTACTGTAATGGATATGGATATAAAAACTGTCCACAAAAACAACATTAAACAGAACAGAAAATA
CGCCTAGCTACCATAGACCTCCAAAACACCTCACTTCTTCTTAGCTGCAGATTTGGTGACCTTGGCACCTGATGGGTCCTTCTTGTCGACACTCTTGATG
ACACCAACAGCCACTGTCTGACGCATGTCCCTAACAGCAAAACGACCAAGGGGAGGGTACTCAGAGAATGTCTCGACAACCATGGGCTTGGTTGGAACCA
TCTTAACGAACCCAGCATCACCATTCTTCAAGAACTTGGGCTCCTTCTCAAGCTCCTTGCCAGATCGTCTGTCAATCTTGGTCAAGATCTCAGAGAACTT
AACAGCAATGTGGGAGGTGTGGCAGTCGAGCACTGGGGCATATCCATTACCAATCTGGCCAGGGTGGTTCATGATGATGACCTGAGAGGTGAAGTTAGCA
GCCCCCTTGGCAGGATCATCCTTGGAGTTAGAAGCAACAAAACCACGCTTGAGATCCTTGACAGCAACATTCTTAACGTTGAAACCCACATTGTCACCAG
GAAGAGCCTCCTGGAGAGCTTCATGGTGCATCTCAACGGACTTAACTTCAGTGGTCAGTCCAGTGGGGCCAAATGTAACAACCATACCAGGCTTGAGGAC
ACCGGTTTCCACACGACCCACTGGTACAGTTCCAATACCACCAATCTTGTACACATCCTGAAGTGGAAGACGCAGGGGCTTGTCTGAGGGCCTCTTGGGC
TCATTGATTTGATCAAGAGCCTCAAGGAGGGTTGGACCCTTGTACCAGTCGAGGTTGGTAGACCTCTCAATCATGTTGTCACCCTCAAAACCAGAGATGG
GGACAAAGGGGATCTTGTCAGGGTTGTACCCGACCTTCTTCAGGTAGGAAGAGACTTCCTTCACGATTTCATCATACCTTGCCTTGGAGTATTTTGGGGT
TGTGGCATCCATCTAAAATGAATTGCACAAAATCAACATAAGT