Detailed information on CNT30158551


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30158551

Peptides detected in this lncRNA

>peptide 1 (89 aa)
AYAIMHKMFFLSYFYFLVLFLFLFYFFLFFSFLSCFSFLFFSYFSLLFFSCFSFLLFSWLVQVFSFFLVLILILSHSFLFLFFSFLSLC*

>peptide 2 (43 aa)
MWEFLLSTHGSPSQQPILFSYLTLFNSLMLILPFSLFLECFILY

Sequence

>CNT30158551
TGCATATGCAATAATGCATAAAATGTTTTTTCTTTCTTATTTCTATTTTCTTGTTCTATTTCTTTTCTTGTTCTATTTCTTTCTATTCTTTTCTTTTCTT
TCTTGTTTCTCTTTCCTTTTCTTTTCTTATTTTTCTCTTCTTTTCTTTTCTTGTTTTTCTTTTCTTCTCTTTTCTTGGCTTGTTCAAGTCTTCTCATTCT
TTCTTGTTCTTATTCTTATTCTTTCTCATTCTTTCTTATTCTTATTCTTTTCTTTTCTTAGTCTTTGCTGATCAGACTCAGTTGATGTATGGATTTGGAA
CCTTGGCCGTGTGAGTGAGTACAATCCTCATCTATATGCACTCTTGCAGACCGTACAACTTTTCCTTTCTTCTTAGGCCACTCAATTAAGGTGGCGTGCA
TGTAGGAATTCTTCTTGGTACAACCCTCATCCACATACACTCTTACAGGTCGTACAATTCTTCTTCTTCTTATGCCACTCAATTAAGGTGGCGTGTATGT
GGGAATTTCTTCTTAGCACTCACGGTTCCCCATCACAACAACCTATTCTTTTCTCTTATTTAACACTCTTTAATTCTTTAATGCTTATTCTTCCTTTCTC
TTTATTCTTAGAGTGTTTTATTCTTTATTC