Detailed information on CNT3015747


BLAST search results

BLAST vs Swiss-Prot:
sp|Q41803|EF1A_MAIZE, E-value = 1e-120

BLAST vs NONCODE:
NONMEST004097, E-value = 5e-103

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672978Zea maysSetaria viridis81.6575.0390.74583forward
CNT30614172Zea maysArabis alpina99.370.984.91709forward
CNT30598015Zea maysFraxinus excelsior70.3110086.65502forward
CNT30580076Zea maysEchinochloa crusgalli84.7345.7392.23605forward

Expression of CNT3015747

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MMMTWEVKLAASLAGSSLELEPHGASQRT*

>peptide 2 (77 aa)
LLHTLDDSDSHRLPHVTDSKSTKRRILRKGLHHHGLSGNHLHHTSITVLEKFGLLLQLLAGSPINLGNELSKLDSNV*

>peptide 3 (54 aa)
MVHLNGLNLSSKTSRPKSNNHTRLNDTSLNTSNRDSSNTTNLVHILKGETQGLV*

>peptide 4 (53 aa)
MGLVGTIFTIPASPFLRNLGSFSSSLPDRLSILVTSSANLTAMCEVWQSRTGA*

Sequence

>CNT3015747
TTCTTCTCCACACTCTTGATGACTCCGACAGCCACCGTTTGCCTCATGTCACGGACAGCAAATCGACCAAGAGGAGGATACTGAGAAAAGGTCTCCACCA
CCATGGGCTTAGTGGGAACCATCTTCACCATACCAGCATCACCGTTCTTGAGAAATTTGGGCTCCTTCTCCAGCTCCTTGCCGGATCGCCTATCAATCTT
GGTAACGAGCTCAGCAAACTTGACAGCAATGTGTGAGGTGTGGCAGTCCAGAACTGGGGCATAGCCATTGCCAATCTGGCCAGGGTGGTTCATGATGATG
ACCTGGGAGGTAAAGCTAGCAGCCTCCTTGGCAGGGTCATCCTTGGAGTTGGAGCCTCATGGTGCATCTCAACGGACTTAACCTCAGTAGTAAGACCAGT
AGGCCCAAAAGTAACAACCATACCAGGCTTAATGACACCAGTCTCAACACGTCCAACAGGGACAGTTCCAATACCACCAATCTTGTACACATCCTGAAGG
GGGAGACGCAGGGGCTTGTCTGAAGGCCTCTTTGGCTCATTGATCAAGTCCAGAGCCTCAAGTAGGGTTGGGCCCTTGTACCAGTCAAGGTTGGTGGACC
TCTCAATCATGTTGTCACCTTCAAAACCAGAGATTGGAACGAAGTGGATCTTATCAGGGTTGTATCCAACCTTCTTCAGGTAGGAAGAGACTTCCTTCAC
AATCTCATCATAAC