Detailed information on CNT30156253


BLAST search results

BLAST vs Swiss-Prot:
sp|P48386|CHS1_CAMSI, E-value = 2e-143

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3096662Pistacia veraSolanum tuberosum27.2123.2580.19212forward
CNT30171495Pistacia veraTrifolium pratense21.8220.7181.18170forward

Expression of CNT30156253

Peptides detected in this lncRNA

>peptide 1 (66 aa)
MSINSPITVRQNCLSRRDYFKHWLLNSGNWIRTNDDSSCTITKQGLTHKTVKVGVTRTTESNSSNF*

>peptide 2 (37 aa)
HDENNSVIKITISLLVLVEGNNIDNKKLKDNEKLNQQ*

Sequence

>CNT30156253
CCATGATGAAAATAATTCAGTCATTAAGATTACAATTTCATTATTGGTTTTAGTAGAGGGAAATAACATAGACAATAAAAAACTCAAGGATAACGAAAAA
TTAAATCAACAATAAAAATCTTTAAGCGGTTGCAACACTGTGGAGGACGACTGTCTCAACAGTAAGTCCGGGCCCGAATCCGAAGAGAACTCCCCATTCA
AGACCTTCTCCTGTGGTCTTTAATCCACTTTCAGTTGATTTCCTTCTCATTTCGTCCAAAATAAACAAGACACAGGCGCTTGACATGTTACCGTACTCGG
AAAGCACATGTCTTGTGGCACCTAACTTCTCTTCCTTAAGGCCCAATTTGATTTCAACTTGATCCAAAATTGCCGGACCACCAGGGTGTGCAATCCAGAA
AAGTGAGTTCCAATCTGAGATACCCAAAGGTTTGAATGCCTCAACCAAACTCTTCTCAATGTTCTTTGAAATAAGCCCGGGAACATCTTTCAAAAGGTGA
AATGTAAGCCCAACTTCACGAAGATGTCCATCAATAGCCCCATCACTGTCAGGCAAAATTGTTTGAGCCGTAGAGACTATTTCAAACATTGGCTTCTCAA
CTCCGGGAACTGGATCAGAACCAACGATGACAGCAGCTGCACCATCACCAAACAAGGCTTGACCCACAAGACTGTCAAGGTGGGTGTCACTAGGACCACG
GAAAGTAACAGCAGTAATTTCTGAGCAGACGACAAGGACACGAGCACCTTTGTTGTTCTCAGCCAAGTCTTTGGCAAGG