Detailed information on CNT30156094


BLAST search results

BLAST vs Swiss-Prot:
sp|P69325|UBIQP_SOYBN, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30500417Pistacia veraCoffea canephora70.6143.382.45872forward
CNT30724005Pistacia veraLupinus angustifolius70.6967.6283.05873forward

Expression of CNT30156094

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MVSELSTSKVIVLPVRVLTKICIPPRRRRTKWSVDSFWIL*

>peptide 2 (61 aa)
MTNSETPTETEHKMQGGLLLNVVISKGPSILKLLPSKNQPLLVWWDPLLILDLSLNIVNGI*

>peptide 3 (31 aa)
MVSELSTSRVIVFPVRVFTKICIPPLRRRTK*

Sequence

>CNT30156094
GGCTGTTATTATTAACTCAGGCAAAGCAAACAAATAGGCATTGGCTCAAGTGAGATCATACACCAAGGATATATACTAAGCGCCATAATATGTATTTATT
TAATATAAGTTCTTAGAACTGATATACATGATCTAAAGAACGCCCATATCAGCATCTAAGAAACACAGCGCAAAAAGCATAAAAACTAAAAAACTTAAAA
TAGAGTTTTTACAACTTATTTAAGACATTAAATATTGGCCAGCGGCCAGACCACACCACACAAACAACCACATATCCAACATAATGGAAACAAACCAGAT
TCAAATAAGCACATGACCAATTCAGAAACCCCCACGGAGACGGAGCACAAGATGCAGGGTGGACTCCTTCTGAATGTTGTAATCAGCAAGGGTCCTTCCA
TCCTCAAGCTGCTTCCCAGCAAAAATCAACCTCTGCTGGTCTGGTGGGATCCCCTCCTTATCCTGGATCTTAGCCTTAACATTGTCAATGGTATCTGAAC
TCTCAACCTCCAAGGTGATTGTCTTACCAGTGAGGGTCTTGACAAAAATCTGCATACCACCACGGAGACGAAGGACCAAGTGGAGTGTGGATTCCTTCTG
GATATTATAGTCTGCAAGTGTCCTCCCATCTTCAAGCTGCTTACCAGCAAAAATGAGCCTCTGCTGATCTGGTGGGATACCCTCTTTGTCTTGGATTTTG
GCTTTCACATTGTCAATTGTGTCAGAACTCTCAACCTCCAAGGTAATGGTTTTTCCAGTAAGGGTTTTCACAAAGATCTGCATACCACCCCTGAGTCGAA
GGACCAAGTGAAGGGTGGACTCCTTCTGGATGTTATAGTCAGCAAGTGTGCGTCCATCCTCAAGTTGTTTGCCAGCGAAGATAAGCCTCTGCTGGTCTGG
TGGGATTCCTTCCTTATCCTGAATTTTGGCTTTGACATTGTCAATGGTGTCAGAGCTTTCCACCTCAAGGGTGATTGTCTTTCCAGTGAGGGTTTTCACG
AAGATCTGCATACCACCCCTTAGACGGAGGACCAAGTGAAGGGTTGACTCTTTCTGGATGTTATAATCTGCAAGTGTACGCCCATCCTCGAGTTGTTTAC
CAGCAAAGATAAGCCTTTGCTGGTCTGGCGGGATCCCTTCCTTGTCCTGAATTTTGGCCTTGACATTGTCAATGGTGTCAGAGCTTTCAACCTCAAGGGT
GATTGTCTTTCCGGTGAGAGTTTTCACAAAGATTT