Detailed information on CNT301496


BLAST search results

BLAST vs Swiss-Prot:
sp|P10979|GRPA_MAIZE, E-value = 5e-15

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30299705Zea maysTriticum aestivum23.9251.2190.55127forward

Expression of CNT301496

Peptides detected in this lncRNA

>peptide 1 (70 aa)
MLRPSSSLPFMPSMALWREWSSVAQARPPTKQRYSTSDAAISIRSPTNPNPGEPHEPEPEPEGEEKPTHL*

Sequence

>CNT301496
ACGACACGAACGAAGATAAACCCTCTGGACTAGGGTAAACATCACGGTAGCGAACAGGATAACTTGGCCGCGCGGGCCCCACCGCTCAGTTCCTCCAGTT
CCCGTCGGAGTTGCCGTAGCCGCCGCCACGGTTGCCACCGCCGTAGCCGCCGCCACCACCACCGTAGCCGCCGCCGCCACCGTAGCCGCCGCCACCGCCG
TAGCCGCCACCGCCATCACGGCGCCCGCCACCGCCGTAGCCGCCGCCTCCACGGCCACCACCGTACCCACCGCCGCCGCCTCCACGGCCGCCGCGGGACT
GGGCCTCGTTGACGGTGATGTTGCGGCCGTCCAGCTCCTTGCCGTTCATGCCCTCGATGGCGTTGTGGAGGGAGTGGTCGTCCGTGGCCCAGGCGAGGCC
GCCGACGAAGCAGCGGTACTCAACATCCGACGCCGCCATCTCGATCCGCTCACCCACGAACCCGAACCCCGGAGAACCTCACGAACCCGAACCCGAACCG
GAGGGGGAGGAGAAGCCAACCCACCTCTAAG