Detailed information on CNT3014814


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672674Zea maysSetaria viridis50.861.393.33255forward
CNT30570425Zea maysVitis vinifera22.116.3983.78111forward

Expression of CNT3014814

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MPPKKNPPVNLAQPSAVCSLSASFFLPGGWRGTTPRAGWR*

Sequence

>CNT3014814
TTGGGAAAATGGAAATCCTTTGAAAAAATGAGGTTAACAAACTAGCTCTGAATGATGCATCCAATAAGGTAAAAAAAAGTTGAACAGGTTACATCCCAAT
CCATCCATGTGCAAAGCAGAGGAATTACATTTATACACGGCGCTGATCACCGCTGGAGTGAAATGAAACAAGGACCACACCACCTACATACCATGCAGCT
AGAGAGGAGGATCGGCCGGAGCTATATATATACGCATCTTTGATGATTTCTACTTGAAGAAGTAGGGGAGGTCGAGCACGTAGAGGAGAAAGTAGGCCCA
GAGCACGCCGGAGATGCCGCCGAAGAAGAACCCCCCGGTGAACTTGGCCCAGCCGTCGGCGGTCTGCAGCTTGTCGGCCTCCTTCTTCCTGCCGGGAGGT
TGGAGAGGTACCACGCCACGAGCGGGCTGGAGGTGACCGGCGTCTCCAGGCTGCCGATGAACGGGTCGCCGTTGATGGGCTGCACCACCTGGTACGTTGC
CT