Detailed information on CNT301476


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692141Zea maysOryza sativa28.9614.1697.8995forward
CNT30317088Zea maysCorylus avellana23.4810.5390.9177forward
CNT30703372Zea maysQuercus lobata24.3918.686.2580forward
CNT30616476Zea maysSesamum indicum25.316.7393.9883forward
CNT30589607Zea maysMusa acuminata26.5222.1994.2587forward
CNT30552977Zea maysOryza glaberrima28.9614.1897.8995forward
CNT30132965Zea maysLolium perenne28.9620.790.5395forward
CNT30231564Zea maysAnanas comosus29.277.3694.7996forward
CNT30345256Zea maysEragrostis tef30.1819.2693.9499forward
CNT30361694Zea maysSorghum bicolor17.9926.794.9259forward
CNT30595924Zea maysOryza meridionalis30.1820.4595.9699forward
CNT30101081Zea maysOryza rufipogon28.967.897.8995forward
CNT30116289Zea maysOryza nivara28.9612.1597.8995forward
CNT30113588Zea maysFicus carica25.313.1590.3683forward

Expression of CNT301476

Peptides detected in this lncRNA

>peptide 1 (51 aa)
MIMDSSIISSVGVVVEGCVRLLVGQVRALHRDVAVVSEVEAVDGLVAVAVAV

>peptide 2 (37 aa)
LCVLLLIGTTTHSRIEETSHTHIRVAKLRLRVRSTDE*

>peptide 3 (52 aa)
MDDNGFINHQFSWCSCRGMRTTPRRSGTGPAPRCGRSLRSRSCRWPRSGRRCG

Sequence

>CNT301476
CCCTCTGCGTCTTATTGCTTATTGGTACTACCACGCACTCACGAATTGAAGAAACCAGCCATACACACATAAGAGTAGCCAAACTACGGCTACGAGTGAG
GAGTACTGATGAGTAGCAGGGGAGCTTGTCTCGTCAAGTTCTGACAGCCGCGACAGACAGAGCAGAGATGGATGATAATGGATTCATCAATCATCAGTTC
AGTTGGTGTAGTTGTCGAGGGATGCGTACGACTCCTCGTAGGTCAGGTACGGGCCCTGCACCGAGATGTGGCCGTAGTCTCCGAAGTAGAAGCTGTAGAT
GGCCTCGTAGCGGTCGCCGTTGCGGTCG