Detailed information on CNT30147125


BLAST search results

BLAST vs Swiss-Prot:
sp|P36907|CHIX_PEA, E-value = 1e-45

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30147125

Peptides detected in this lncRNA

>peptide 1 (48 aa)
LPLTGGIITSSTKSIKRSSRGNETIVGIKSMTSTTLIISIFKHLIKQR*

Sequence

>CNT30147125
AGCTCCCTCTTACGGGTGGTATCATCACCAGTAGTACCAAATCCATTAAAAGATCTAGTCGCGGCAATGAAACCATCGTAGGTATAAAATCCATGACCAG
CACAACGTTGATCATTTCGATATTTAAGCATTTGATCAAACAAAGATGATGGAATAATACTTCCAACATCTCCACCACCACCTGTACTAGGTGTTGGTGG
GTTCGGTGTCGGAGAAGATTTACATTGGCTCTGACAACCATCTCCACAATATTGATCAGTGTTGCCACAAAAACCAAATTTGCTGCAACATAGCCCATTT
GGGCAAAGAGCTCCATTAGCTTGACTACCACATTGCTCAGCTTTGGCTACAAGAAAGAGAGGTAGTAAACATAGTATCAAGCAAGATAAGTTTGTATTCG
CCATTTTCGAGAGTGGAGTCGGTTTGGTG