Detailed information on CNT30147063


BLAST search results

BLAST vs Swiss-Prot:
sp|P69325|UBIQP_SOYBN, E-value = 0.0

BLAST vs NONCODE:
NONTPRT002153, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30376617Medicago truncatulaArabidopsis thaliana71.2272.8881.84782forward
CNT3019984Medicago truncatulaCitrullus lanatus82.759.8582.49908forward
CNT30526024Medicago truncatulaPhaseolus vulgaris83.0668.9383.66912forward
CNT3095105Medicago truncatulaSolanum tuberosum81.9777.4583.11900forward
CNT3086267Medicago truncatulaVigna radiata83.5247.8989.2917forward
CNT30172216Medicago truncatulaTrifolium pratense83.753.9391.95919forward
CNT30724005Medicago truncatulaLupinus angustifolius82.670.2688.31907forward

Expression of CNT30147063

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MESGFLLDVIISKGTPILQLLASKNQSLLVWWDSFLVLNFCLNIVYGI*

>peptide 2 (61 aa)
MSLCWSGGIPSLSCILALTLSMVSELSTSRVIVFPVRVFTNICIPPRRRSTKWRVDSFWML*

>peptide 3 (48 aa)
MKSGFFLDVIICQGSAIFKLLSSKNQPLLVWGNAFLVLNLSLYIVNCV*

Sequence

>CNT30147063
ATGACAGCAATTAGTTCATATTCATTAAGTTTAACAAAGAGAAAGAGAACAGATACGAGTACCACAACAAACTAAAGATAAGGGCCATTATCAAGACCCA
TGCAACAAGTTCTGAAATTGGAAAACCATAAACCTGCTTAGGATTCAACACACAATAAAAGACAACTACACAAACCTAAATACTTAAAATCCACCACGAA
GACGCAAAACAAGGTGAAGAGTAGACTCCTTCTGAATGTTGTAGTCAGCAAGGGTCCTTCCATCCTCCAATTGCTTCCCAGCAAAGATCAACCTCTGCTG
ATCTGGTGGGATTCCTTCCTTGTCCTGGATTTTTGCCTTCACATTATCAATTGTGTCTGAACTTTCTACCTCTAAGGTGATGGTCTTACCGGTCAACGTC
TTCACAAAGATCTGCATGCCTCCCCTCAGACGAAGGACAAGATGAAGAGTGGATTCTTTCTGGATGTTATAATCTGCCAAGGTTCTGCCATCTTCAAGCT
GCTTTCCAGCAAAAATCAACCTTTGCTGGTCTGGGGGAATGCCTTCCTTGTCCTGAATCTTAGCCTTTACATTGTCAATTGTGTCTGAGCTCTCCACCTC
CAAAGTAATCGTTTTTCCAGTTAGGGTCTTAACAAAAATCTGCATACCACCACGAAGTCGCAAGACAAGATGAAGAGTCGACTCTTTCTGGATGTTATAA
TCAGCTAGAGTTCTGCCATCTTCAAGCTGTTTTCCAGCAAAGATGAGCCTCTGCTGGTCTGGTGGGATACCCTCTTTGTCTTGTATCTTGGCCTTAACAT
TGTCAATGGTATCAGAGCTCTCCACCTCAAGGGTAATCGTCTTTCCAGTGAGAGTCTTCACAAATATTTGCATACCACCACGGAGACGGAGCACCAAATG
GAGAGTGGATTCCTTTTGGATGTTATAATCAGCAAGGGTACGCCCATCCTCCAGCTGCTTGCCAGCAAAAATCAGTCGCTGCTGGTCTGGTGGGATTCCT
TCCTTGTCTTGAATTTTTGCCTTAACATTGTCTATGGTATCTGAACTCTCAACTTCGAGAGTGATGGTCTTGCCAGTGAGGGTCTTAACGAAGATTTG