Detailed information on CNT30146819


BLAST search results

BLAST vs Swiss-Prot:
sp|A4PU48|METK_MEDTR, E-value = 7e-111

BLAST vs NONCODE:
NONPOPT000587, E-value = 2e-50

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672441Medicago truncatulaSetaria viridis37.6836.5284.45283forward
CNT30520816Medicago truncatulaSetaria italica38.8833.884.59292forward
CNT30639623Medicago truncatulaNymphaea colorata23.734.1782.58178forward
CNT30549537Medicago truncatulaIpomoea triloba33.1637.3984.34249forward
CNT30698521Medicago truncatulaQuercus lobata26.3635.2983.84198forward
CNT30374620Medicago truncatulaArabidopsis thaliana38.2233.1483.28287forward
CNT30618114Medicago truncatulaSesamum indicum29.4348.8982.81221forward
CNT30729048Medicago truncatulaCorchorus capsularis20.2423.1788.16152forward
CNT30381460Medicago truncatulaManihot esculenta53.2643.5383.75400forward
CNT30524850Medicago truncatulaPhaseolus vulgaris48.7450.6986.34366forward
CNT30628391Medicago truncatulaVigna unguiculata52.4634.3586.04394forward
CNT30490001Medicago truncatulaOlea europaea30.6346.3781.74230forward
CNT30712616Medicago truncatulaGlycine max46.8743.388.64352forward
CNT30638840Medicago truncatulaCapsicum annuum27.8324.4782.78209forward
CNT30508528Medicago truncatulaSolanum lycopersicum19.0427.5583.22143forward
CNT30172560Medicago truncatulaTrifolium pratense40.4844.6492.76304forward
CNT30667060Medicago truncatulaTriticum dicoccoides21.1725.0481.76159forward
CNT3059692Medicago truncatulaArabidopsis lyrata8.2621.4588.7162forward
CNT30471290Medicago truncatulaSaccharum spontaneum37.8231.6383.8284forward
CNT3013982Medicago truncatulaZea mays22.2457.5983.83167forward
CNT30608385Medicago truncatulaGossypium raimondii22.530.7388.76169forward
CNT30218668Medicago truncatulaKalanchoe fedtschenkoi29.8357.8882.59224forward
CNT30624603Medicago truncatulaDaucus carota38.6243.9484.14290forward
CNT30349162Medicago truncatulaEragrostis tef41.2834.0385.16310forward
CNT30367875Medicago truncatulaSorghum bicolor22.2420.1986.83167forward
CNT30620815Medicago truncatulaCajanus cajan23.5724.2186.44177forward
CNT30597069Medicago truncatulaOryza meridionalis35.0213.1485.93263forward
CNT3055182Medicago truncatulaAmborella trichopoda27.4319.4982.52206forward
CNT3022562Medicago truncatulaPopulus trichocarpa52.225.0684.44392forward
CNT30496713Medicago truncatulaDigitaria exilis22.3711.1682.14168forward
CNT30594307Medicago truncatulaEragrostis curvula9.9921.3785.3375forward
CNT30551132Medicago truncatulaOryza brachyantha11.0521.584.3483forward

Expression of CNT30146819

Peptides detected in this lncRNA

>peptide 1 (93 aa)
MGTTNDKASRRVKVEDCLLIQVLLGNNRLDNMFLKISSNLVVTDSLVVLSRNEDSVDTNWNHSTVLIVVLDGNLCLAVRSQPSAGTILPNLGKT

>peptide 2 (44 aa)
MTKRPEGLRWKIVFSSKYFSGITGLITCSLRSAAIWSLLTVSSC*

Sequence

>CNT30146819
CGACGAAACAACAAAAGTAGCAACAATTAACTAAACACGCAAATTATTCATCCACACCTAATAAGACAACCGTCAAAGGGACGAATATAAATCCGCAACA
CAATTCTTAAGCTTGAGGCTTCTCCCACTTGAGTGGTTTCACAACTTCCCATGTGAAGTCAGGATCATCCCTTCCAAAGTGTCCATAAGCAGCTGTCTTA
AGAAACCTGCTGTTGCCACCCCTCTTAAGGTCCAAGTTTATGGTGATCATTCCAGGTCTGAAGTCGAAATTCTCCTTCACAATTTGAAGAATCTCCCTGT
CAGGAATCTTTCCAGTTCCATAACTGTCAACAAAGACCGACAAAGGTTCAGGCACCACTTCTGTCAACCTTGGTTGGGTCCTTTCCTGAGAAGGCACCTC
CACCGTGAGCACCCCAGCCACCATAAGTATCAATTATAATCTTTCTTCCGGTGAGACCGGCATCACCATGGGGACCACCAATGACAAAGCGTCCAGAAGG
GTTAAGGTGGAAGATTGTCTTCTCATCCAAGTACTTCTCGGGAATAACAGGCTTGATAACATGTTCCTTAAGATCAGCAGCAATCTGGTCGTTACTGACA
GTCTCGTCGTGTTGAGTAGAAATGAGGACAGTGTGGACACGAACTGGAACCATAGCACCGTTCTCATTGTAGTACTCGATGGTAACTTGTGTCTTGCCGT
CAGGTCTCAACCAAGCGCAGGTACCATTCTTCCTAACCTCGGTAAGACGAG