Detailed information on CNT30146728


BLAST search results

BLAST vs Swiss-Prot:
sp|Q84VT2|FAD12_PUNGR, E-value = 2e-82

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30375610Medicago truncatulaArabidopsis thaliana27.6713.2282.35119forward
CNT30617145Medicago truncatulaSesamum indicum17.4425.4293.3375forward
CNT3021318Medicago truncatulaCitrullus lanatus51.42582.81221forward
CNT30382289Medicago truncatulaManihot esculenta34.6517.7888.59149forward
CNT30524830Medicago truncatulaPhaseolus vulgaris61.1640.2885.93263forward
CNT30507568Medicago truncatulaNicotiana attenuata40.9323.6282.95176forward
CNT30712523Medicago truncatulaGlycine max84.1964.7685.36362forward
CNT3091031Medicago truncatulaSolanum tuberosum42.337.8581.87182forward
CNT30559188Medicago truncatulaActinidia chinensis30.2312.5285.38130forward
CNT30509059Medicago truncatulaSolanum lycopersicum35.3530.1682.89152forward
CNT30314096Medicago truncatulaCamelina sativa43.4938.0182.35187forward
CNT3075396Medicago truncatulaBrassica juncea40.2337.9479.19173forward
CNT30611984Medicago truncatulaArabis alpina27.6717.9282.35119forward
CNT30650498Medicago truncatulaRosa chinensis78.659.9381.66338forward
CNT30717698Medicago truncatulaMalus domestica golden31.1621.7287.31134forward
CNT30626192Medicago truncatulaDaucus carota40.2334.4681.5173forward
CNT30620011Medicago truncatulaCajanus cajan94.4216.1485.96406forward
CNT30154726Medicago truncatulaPrunus persica57.4435.1983.81247forward
CNT30705704Medicago truncatulaPrunus avium78.3716.6381.9337forward
CNT30323306Medicago truncatulaAsparagus officinalis33.2636.0280.42143forward
CNT30120535Medicago truncatulaCitrus clementina25.5825.2981.82110forward

Expression of CNT30146728

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MLDFCLGTKTSSRSREPVLEWWRRWLYFHEK*

>peptide 2 (40 aa)
MVATLMCNDPNTGKDATLDSPVSRPGQERERARKVQKKEEM

Sequence

>CNT30146728
GTTAAAGTGGCAAGCAAATCTATCATAAGGCCTGCCTGAAACATTGAGAGCCAGGTAAAGGGGCCAGCCAAGAGTGAGGGTGATGGTAATGGTGAGGACT
CTGCCTAGTGGGTTGTTGCTAAGGTATTTGGAGTACCAATAGATGCTGGACTTCTGTTTGGGCACAAAGACTTCATCCCGCTCAAGAGAACCGGTGTTGG
AATGGTGGCGGCGATGGCTGTATTTCCATGAAAAGTAAGGCACAAGAAGGGCAGAGTGGAGAATAAGGCCAACTGTATCATCAAGCCATTGATAGTCACT
GAATGCATGGTGGCCACACTCATGTGCAATGACCCAAACACCGGTAAGGATGCAACCTTGGATAGCCCAGTAAGCAGGCCAGGCCAAGAAAGAGAGAGGG
CGAGGAAGGTGCAAAAAAAGGAGGAAATGG