Detailed information on CNT30146630


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9FY14|TIP1_MEDTR, E-value = 4e-55

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30628528Medicago truncatulaVigna unguiculata45.9122.7784.16202forward
CNT30712649Medicago truncatulaGlycine max72.7344.5184.38320forward
CNT30619970Medicago truncatulaCajanus cajan44.7751.384.26197forward
CNT30176366Medicago truncatulaVigna angularis45.9142.1783.17202forward
CNT30724837Medicago truncatulaLupinus angustifolius41.8221.9882.61184forward

Expression of CNT30146630

Peptides detected in this lncRNA

>peptide 1 (70 aa)
RSGDKDKEGGSNNGSEELSDDVNDTTEEGDVTTNEDSNKESECMGDGGRDETGRGGSTVVGKLVVCDTGT*

>peptide 2 (63 aa)
MLPPTKTATKRANAWAMEAEMRPAGVAAPSLVSLLYAIPEPEPAKTKMKVEMNSAKPAFKVSG*

Sequence

>CNT30146630
CGAAGCGGTGACAAAGACAAGGAGGGCGGAAGCAACAATGGATCCGAGGAGTTGAGCGATGATGTAAACGATACCACGGAGGAGGGTGATGTTACCACCA
ACGAAGACAGCAACAAAGAGAGCGAATGCATGGGCGATGGAGGCAGAGATGAGACCGGCAGGGGTGGCAGCACCGTCGTTGGTAAGCTTGTTGTATGCGA
TACCGGAACCTGAACCGGCAAAGACAAAGATGAAGGTTGAGATGAACTCAGCCAAACCTGCTTTCAAGGTGTCTGGGTGAGTTGCCTCTTGAGGTGTTCC
TACGGCGATGTTTCTGATAGGCATGTTGAAATAATCGCTTTTGTTAACAAACACTCACTCTTTTTTTTTAGTTACTGTGAAAGCGCTTTCTGGTTTTCGC
TTCTGCTTGTTTTCGTTTCCTATCTTGTGTGTTACTTATA