Detailed information on CNT30146612


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH33|UBQ11_ARATH, E-value = 6e-88

BLAST vs NONCODE:
NONTPRT002153, E-value = 3e-110

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30146612

Peptides detected in this lncRNA

>peptide 1 (47 aa)
PNYYTTDVTHISYLKQVPTMGNRKLLLTQSRVVMNQQVIIRVSDKTT*

Sequence

>CNT30146612
ACCAAACTACTACACTACAGATGTAACACATATCTCCTACCTGAAACAAGTACCTACCATGGGTAATAGAAAACTTCTACTTACTCAAAGTAGAGTAGTA
ATGAATCAGCAGGTAATTATTAGAGTATCAGATAAAACAACTTGAGAGCACTTAAAAGCTGCTACGAAAACAAATAGTTCACATTCATTAAGTAGAACTA
GAACAGAATCATACACAAGAAATAAAACGATAGTTTTCCAGGGCCATTACGGACCCAGCACAAGTTCTAAAACATAAAAACTAACAACTGTAGAAGTTCA
ACACGTGATAAGAGAGTAGGCAACATTCACATTCTTAAAACCCACCACGAAGTCGCAAAACGAGATGAAGAGTTGACTCTTTCTGGATGTTATAATCGGC
CAATGTTCTGCCATCTTCAAGCTGTTTTCCAGCAAAGATGAGCCTCTGCTGGTCAGGTGGGATCCCTTCCTTGTCTTGAATCTTGGCCTTGACATTGTCA
ATTGTATCGGAGCTCTCCACCTCAAGAGTGATTGTTTTTCCTGTGAGAGTCTTCACAAAGATTTGCATCCCACCACGAAGACGGAGCACCAAGTGGAGTG
TGGACTCCTTTTGGATGTTGTAATCTGCAAGGGTACGCCCGTCTTCCAGCTGCTTGCCGGCAAAAATTAGACGCTGCTGGTCTGGAGGGATCCCTTCCTT
GTCTTGAATCTTGGCCTTAACATTGTCAATTGTAT