Detailed information on CNT30146188


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONGMAT000814, E-value = 2e-102

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30518292Medicago truncatulaJuglans regia44.8476.6986.08352forward
CNT30618428Medicago truncatulaSesamum indicum22.0435.0990.17173forward
CNT30629544Medicago truncatulaVigna unguiculata34.2735.5888.1269forward
CNT30637620Medicago truncatulaCapsicum annuum35.9214.6986.52282forward
CNT30296842Medicago truncatulaTriticum aestivum34.6539.0287.13272forward
CNT3084119Medicago truncatulaVigna radiata45.2219.9485.07355forward
CNT30440878Medicago truncatulaAegilops tauschii31.5931.5587.9248forward
CNT30248159Medicago truncatulaAvena sativa33.8924.2989.1266forward
CNT3076676Medicago truncatulaBrassica juncea43.8230.289.83344forward
CNT30598511Medicago truncatulaFraxinus excelsior45.3554.6983.99356forward
CNT3015474Medicago truncatulaZea mays43.4459.385.04341forward
CNT30203420Medicago truncatulaHelianthus annuus25.139.2489.34197forward
CNT30685098Medicago truncatulaTriticum urartu46.2424.6986.5363forward
CNT30424894Medicago truncatulaPapaver somniferum44.8447.3187.78352forward
CNT30706335Medicago truncatulaPrunus avium45.2231.5687.89355forward
CNT30644842Medicago truncatulaCannabis sativa29.6857.6788.84233forward
CNT3052982Medicago truncatulaAmborella trichopoda35.9221.5684.04282forward
CNT3024873Medicago truncatulaPopulus trichocarpa42.1758.6986.1331forward
CNT30101053Medicago truncatulaOryza rufipogon43.3140.9185340forward
CNT30580076Medicago truncatulaEchinochloa crusgalli44.7126.5385.75351forward
CNT30116111Medicago truncatulaOryza nivara42.5538.1785.33334forward
CNT30726318Medicago truncatulaLupinus angustifolius43.0673.892.6338forward

Expression of CNT30146188

Peptides detected in this lncRNA

>peptide 1 (62 aa)
MSLTAKRPRGGYSAKVSTTMGLVGTILMIPASPFFKNLGSFSISLPDRLSILVTSSANFTAM*

Sequence

>CNT30146188
AGAACCCAGTTCTGTAAGTTTAGCTGCATGAAATCGACAAAAACTTGAAAATAAAACTGGAAAAGAAATGAACTAAGACACTGAAATGATAAACTACTAT
AAAAGACAGCTTGTGCAGCAACCATGTTTTGACATCACTTCTTCTTGGCAGCAGCCTTGGTGACCTTGGCTCCGGTAGGATCCTTCTTCTCCACAGCCTT
GATGACACCAACAGCAACAGTTTGACGCATGTCCCTGACAGCAAAACGTCCAAGAGGAGGATATTCAGCAAAGGTCTCAACCACCATGGGCTTGGTGGGA
ACCATCTTAATGATACCAGCATCACCATTCTTCAAGAACTTGGGCTCCTTCTCAATCTCCTTACCAGATCGCCTGTCAATCTTGGTAACAAGTTCAGCAA
ACTTCACAGCAATGTGAGAGGTTTGTTAGACCAGTGGGTCCAAAAGTCACAACCATACCGGGCTTCACAATACCGGTCTCAACACGTCCGACTGGCACAG
TTCCAATACCACCAATCTTGTAAACATCTTGCAATGGAAGCCTGAGGGGCTTGTCTGTGGGTCTCTTGGGCTCGTTGATCTGGTCAAGAGCCTCAAGGAG
AGTTGGTCCCTTGTACCAGTCAAGGTTGGTGGACCTCTCAATCATGTTGTCACCTTCAAATCCGGAGATGGGAACAAATGGGATTTTGTCAGGGTTGTAA
CCAACCTTCTTCAAGTAGGATGAAACTTCCTTCACGATTTCATCGTACCTAGCCTTTGAGTACTTGGGGGTGGTAGCATCCATCT