Detailed information on CNT30146184


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30194642Medicago truncatulaPisum sativum42.0926.2887.32410forward
CNT30171246Medicago truncatulaTrifolium pratense62.3276.6485.5607forward

Expression of CNT30146184

Peptides detected in this lncRNA

>peptide 1 (50 aa)
MRQRHSPLTYNSIHHNHIFFSLPLSIDPQTRTNYAASLTQNPSRFSLGLL*

>peptide 2 (75 aa)
MNIPVVEVRDMHILVMVGVRCIPVVAVEVVEVLHKVVEMAVVVNRLVVEVSVLEEVVGVINMDIRVEEVSEVVVVA

>peptide 3 (34 aa)
MVSWSPPNSFIHSHRYKFFLCNLIFFLGHFYYTT*

>peptide 4 (44 aa)
KRKELPQFRKINTCKMFINLYYKLQCQRNKNKLKKVKNKIKSMI*

Sequence

>CNT30146184
TAAGAGAAAGGAATTACCTCAATTCAGAAAAATCAATACATGTAAAATGTTCATAAACTTATACTATAAATTGCAATGCCAAAGAAACAAAAATAAATTA
AAAAAAGTAAAAAATAAAATAAAAAGTATGATATAAGAGAGACTATAACAATAAACTCCATAAACAAGAACAGCAGTAGCAGCAGCAGAAGAAAGTGCCA
CTCACACTGATCTTTGCAGGCCCTGAATTATGGTGTCATGGTCTCCTCCAAATTCATTCATTCATTCCCATAGATACAAGTTTTTTCTCTGCAACCTAAT
CTTCTTTCTCGGCCATTTTTATTACACAACTTGAATATCCATAACAATTCAAATCAATATGAGACAGAGACATTCTCCTCTTACCTATAACTCAATCCAC
CATAACCACATTTTTTTTTCACTTCCTTTATCTATTGACCCACAAACAAGGACTAATTATGCTGCTTCCTTGACACAAAACCCTTCTAGGTTCTCTCTTG
GTTTATTGTAATTTGATTTGATTTTTCCTCTAACATTGCGCGACGAGAGTCGCGAGTATGCATGCATATATGACTGAATTTGATTGATGATAAAAATGTG
TTAAAGGTTGGTGGTGGAGTAGGTAAAAGGGTAAGAGGAGAAGTTCTCAAAAGAATCAATAAAAGGGTGGTGGTGGTGGTGATGCATATGAGATTCCAAA
GACAGGTGGTATAGGCCCTTCATATACAGGTGGTGGTGGCGGCGATGAATATACCGGTGGTGGAGGTGAGGGATATGCATATACTGGTGATGGTGGGGGT
GAGGTGTATACCGGTGGTGGCGGTGGAGGTGGTGGAGGTTCTACACAAGGTGGTGGAGATGGCGGTGGTGGTGAATAGACTGGTGGTGGAGGTGAGTGTA
CTGGAGGAGGTGGTGGGGGTGATAAATATGGATATACGGGTGGAGGAGGTGAGTGAGGTGGTGGTGGTGGCGAA