Detailed information on CNT30145973


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONMTRT001437, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30145973

Peptides detected in this lncRNA

>peptide 1 (59 aa)
MGSRPLEGITIIINYCCQKGPTIQKVHHLLLVTKSLVQKGFLVSLLDWVGSTMLTNYIY*

>peptide 2 (36 aa)
MHLLILSSFFIYRKCQTSYHTYRSTKYNLIKPIQEG*

>peptide 3 (43 aa)
MLTTNNHLINFSIHARTVFAILTVVSSFNSSLNKFGGSLNFKQ*

>peptide 4 (43 aa)
MNKCLMLYVSNGQLILIYETLIHIVKFNHFNFLRILLVPAYPC*

Sequence

>CNT30145973
AGAAGACTAATGCTGGAATTTAAATAAACTGATAAAATAAAAACTTCATTCATGATATCAATGAGGCAAGTCATACACTTATATAGCTAGGGTTGTATAC
CCTGCTAGACCTAATACTAATGGGCTCTAGGCCACTAGAAGGAATTACAATAATAATAAACTACTGTTGCCAAAAAGGCCCAACTATTCAGAAGGTCCAT
CATTTGTTGTTGGTAACGAAATCCTTAGTCCAAAAAGGCTTCCTGGTCTCCCTCTTGGACTGGGTCGGGTCTACCATGCTAACAAATTACATATATTAAA
TCTATATACTATTCTACTACTTATATATTTCTCTAGAACTTTCTTTTAACTTCACCACTTAAACCAAAATGGGTAGCACTTGATTAGTCCAATTATCCAA
CAAATCACTCCATGCATCTCTTGATCTTATCCTCGTTTTTTATTTACAGGAAGTGTCAAACCAGCTACCATACCTATAGAAGCACAAAATATAATTTAAT
AAAACCAATTCAAGAGGGGTAAAAAGTAGATAATTAAAGAAAATTAATCATATTCATTCATGTACCTATATAAATGAATGTTAGGAAGTCCATACAAGTT
CCTACATAAGAGATTACGAACAACGTAGCCATAACTCCCACAAACACAGGCCAATCTTTCTTTATGCTTACCACGAACAACCACCTTATTAATTTTTCAA
TCCATGCTCGAACTGTCTTTGCCATTCTCACAGTTGTTTCTTCTTTCAATTCAAGCCTCAACAAGTTTGGTGGTTCCCTAAATTTCAAACAATAAATAAA
TGGAACTTAACTACCTATTTAGAGCACATAGCACCAACACTTCAGAATGAATAAGTGTTTGATGTTATATGTGTCTAATGGCCAATTAATACTCATATAC
GAGACATTGATACATATAGTTAAATTTAATCACTTCAATTTTCTCAGAATATTATTAGTACCTGCGTATCCGTGTTAGTCTACATAATGGAAAAATAGAG
TAATTTGCATTAGAAGTAGAGGAAGGAGAAGGTGCTCACTTGCCGAAAAGTGTAAGCATATTGGAATAGAGGAATATTGAAGTAACAACAAATATAGCGA
GCCATGAGATGAGAGTGAGGAAGTTAAATTGACAAACTTCCAACAACA