Detailed information on CNT30145759


BLAST search results

BLAST vs Swiss-Prot:
sp|P36181|HSP80_SOLLC, E-value = 1e-74

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695408Medicago truncatulaOryza sativa39.3137.1681.21149forward
CNT30675606Medicago truncatulaSetaria viridis50.428.6880.63191forward
CNT30523385Medicago truncatulaSetaria italica50.425.0780.63191forward
CNT30512942Medicago truncatulaJuglans regia55.9441.8183.02212forward
CNT3071729Medicago truncatulaQuercus suber53.8372.8680.39204forward
CNT30402735Medicago truncatulaBeta vulgaris71.7719.9784.56272forward
CNT30526133Medicago truncatulaPhaseolus vulgaris19.7937.586.6775forward
CNT30631181Medicago truncatulaVigna unguiculata103.1773.584.4391forward
CNT30712364Medicago truncatulaGlycine max55.9453.484.43212forward
CNT30158908Medicago truncatulaPistacia vera40.119.383.55152forward
CNT30554909Medicago truncatulaOryza glaberrima45.6544.9479.19173forward
CNT3061941Medicago truncatulaArabidopsis lyrata20.583089.7478forward
CNT30613762Medicago truncatulaArabis alpina52.775083200forward
CNT30652959Medicago truncatulaRosa chinensis56.244.2884.04213forward
CNT30625276Medicago truncatulaDaucus carota53.5614.4483.25203forward
CNT30348495Medicago truncatulaEragrostis tef53.5668.1280.79203forward
CNT30362646Medicago truncatulaSorghum bicolor28.2333.9787.85107forward
CNT30154320Medicago truncatulaPrunus persica19.5320.0590.5474forward
CNT30418103Medicago truncatulaPapaver somniferum52.5151.0383.42199forward
CNT3022206Medicago truncatulaPopulus trichocarpa28.519.8587.96108forward
CNT30103468Medicago truncatulaOryza rufipogon45.6533.0879.77173forward

Expression of CNT30145759

Peptides detected in this lncRNA

>peptide 1 (64 aa)
IRNLFLNSLLNPKRNWIADKFRMFLNQVLQTAFLKILKLILLEDESYLSSPAKSFASCVPSHSE*

Sequence

>CNT30145759
CATCAGAAATCTCTTTCTCAATAGTCTTCTCAACCCAAAGAGAAATTGGATAGCTGATAAATTCAGAATGTTTCTTAACCAAGTCCTTCAGACGGCGTTC
CTCAAGATACTCAAGTTGATCCTCCTTGAGGATGAGAGTTATCTTAGTTCCCCTGCCAAGAGCTTCGCCAGTTGTGTCCCTAGTCACAGTGAATGACCCT
CCAGCTTGAGACTCCCACACATACTGTTCATCATCGTTGTGCTTTGTGGTAACAATAACCTTCTCGGCAGAGTAGAAACCAACACCAAACTGTCCAATCA
TGCTCACATCAGCACCAGCAGCTATGGCTTCCATGAATTCCTTGGTACCAGACCTAGCAATGGTACCTAGGTTGTTCAC