Detailed information on CNT30145430


BLAST search results

BLAST vs Swiss-Prot:
sp|P69322|UBIQP_PEA, E-value = 0.0

BLAST vs NONCODE:
NONMTRT001024, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30316435Medicago truncatulaCorylus avellana41.1294.2683.1722forward
CNT30512897Medicago truncatulaJuglans regia46.2482.2782.76812forward
CNT3069553Medicago truncatulaQuercus suber33.4381.1983.13587forward
CNT30525173Medicago truncatulaPhaseolus vulgaris89.2475.4184.621567forward
CNT30629221Medicago truncatulaVigna unguiculata62.6485.884.451100forward
CNT30199996Medicago truncatulaPisum sativum21.2464.288.47373forward
CNT30712003Medicago truncatulaGlycine max35.0275.5583.9615forward
CNT3086449Medicago truncatulaVigna radiata76.0384.9884.641335forward
CNT3056329Medicago truncatulaAmborella trichopoda47.7872.6481.53839forward

Expression of CNT30145430

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MESGLLLDVIIGKCPSIFKLLTSKDKPLLIRRDTLLILNLSFHIINSI*

>peptide 2 (99 aa)
GRFFLNIVICQSTTILQLLASKNKPLLIWGNTLLILYLCFHIINSIRAFHLQGNSLPSKCLHKYLHATTKPQNQMQSRFLLDIIIGQSTTILQLLSSKN*

>peptide 3 (30 aa)
MVFPVRVLTKICIPPRSLKTKWRVDSFWML*

>peptide 4 (40 aa)
MSSQISACHLSIAAQGEGWIPFGCCNPQGCGHLPIVYQQI*

>peptide 5 (48 aa)
MKGGLLLNVVISERAPVFQLLTGEDKPLLIWRDTLLILNLSFHIINSI*

>peptide 6 (48 aa)
MEGRFLLNVIISKGPSIFKLLTSKDKPLLIGRDTLLILNLSFHIINSI*

Sequence

>CNT30145430
GGGTAGATTCTTTCTGAATATTGTAATCTGCCAGAGTACGACCATCCTCCAACTGCTTGCCAGCAAAAATAAGCCTCTGCTGATCTGGGGGAATACCCTC
CTTATCTTGTATCTTTGCTTTCACATTATCAATAGTATCAGAGCTTTCCACCTCCAAGGTAATAGTCTTCCCAGTAAGTGTCTTCACAAATATTTGCATG
CCACCACGAAGCCTCAAAACCAAATGCAAAGTAGATTCCTTCTGGATATTATAATCGGCCAAAGTACGACCATCCTCCAACTGCTTTCCAGCAAAAATTA
GTCTCTGCTGGTCAGGAGGAATGCCCTCTTTATCCTGAATTTTTGCCTTCACATTATCAATTGTATCAGAACTCTCAACCTCCAAAGTTATGGTCTTTCC
AGTAAGGGTCTTAACAAAAATCTGCATACCCCCACGAAGCCTCAAAACCAAATGGAGAGTGGACTCCTTCTGGATGTTATAATCGGCAAGTGTCCTTCCA
TCTTCAAGCTGCTTACCAGCAAAGATAAGCCTCTGTTGATCAGGAGGGATACCCTCCTTATCTTGAATCTTAGCTTTCACATTATCAATAGTATCTGAAC
TCTCAACCTCCAAAGTAATAGTCTTCCCGGTAAGAGTCTTCACAAATATTTGCATCCCACCTCGAAGCCTCAAAACCAAATGCAGAGTAGATTCTTTCTG
GATATTATAATCAGCCAGAGTACGGCCATCTTCCAACTGCTTGCCCGCGAAAATTAGCCTCTGCTGGTCTGGAGGAATGCCCTCTTTGTCCTGAATCTTT
GCTTTCACGTTGTCAATTGTATCAGAACTTTCAACCTCCAAAGTTATTGTCTTTCCGGTAAGAGTCTTCACAAAAATCTGCATACCACCACGAAGCCTCA
AAACCAAATGGAGGGTCGATTCCTTTTGAATGTTATAATCAGCAAGGGTCCTTCCATCTTCAAGCTGCTTACCAGCAAAGATAAGCCTCTGCTGATCGGG
AGGGATACCCTCCTTATCTTGAATCTTAGCTTTCACATTATCAATAGTATCTGAACTCTCAACCTCCAAAGTAATATTTTTCCGGTAAGGGTCTTTACAA
AAATTTGCATACCACCACGAAGCCGCAAAACCAAATGAAGGGTGGACTCCTTTTGAATGTTGTAATCAGCGAGCGTGCGCCCGTCTTCCAATTGCTTACC
GGCGAAGATAAGCCTCTGCTGATCTGGAGGGATACCCTCCTTATCTTGAATCTTAGCTTTCACATTATCAATAGTATCTGAACTCTCCACCTCCAAAGTA
ATAGTCTTTCCAGTCAAAGTCTTTACAAAAATCTGCATTCCACCTCTTAATCTAAGCACCAGATGAAGGGTAGATTCCTTCTGGATGTTATAATCAGCTA
GGGTTCTTCCATCCTCGAGCTGTTTCCCTGCAAAGATAAGCCTCTGCTGATCAGGAGGGATACCCTCTTTGTCTTGGATCTTGGCCTTGACATTATCAAT
TGTATCAGATGATTCAACCTCAAGGGTGATTGTTTTTCCGGTCAATGTCTTCACAAATATCTGCATGCCACCTCTCAATCGCAGCACAAGGTGAAGGGTG
GATTCCTTTTGGATGTTGTAATCCGCAAGGGTGCGGCCATCTTCCAATTGTTTACCAGCAAATATAAGCCTTTGCTGATCGGGAGGAATACCTTCCTTGT
CTTGAATCTTAGCTTTAACGTTGTCTATGGTATCAGAACTCTCCACCTCGAGGGTG