Detailed information on CNT30145156


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH05|UBI2P_PETCR, E-value = 5e-124

BLAST vs NONCODE:
NONMTRT001024, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30145156

Peptides detected in this lncRNA

>peptide 1 (83 aa)
LHIINCIRTLNLQSYGLSSKGLNKNLHTPTKPQNQMESGLLLDVIIGKCPSIFKLLTSKDKPLLIRRDTLLILNLSFHIINSI*

>peptide 2 (44 aa)
FTLSIVSELSTSKVMVFPVRVLTKICIPPRSLKTKWRVDSFWML*

Sequence

>CNT30145156
CTTCACATTATCAATTGTATCAGAACTCTCAACCTCCAAAGTTATGGTCTTTCCAGTAAGGGTCTTAACAAAAATCTGCATACCCCCACGAAGCCTCAAA
ACCAAATGGAGAGTGGACTCCTTCTGGATGTTATAATCGGCAAGTGTCCTTCCATCTTCAAGCTGCTTACCAGCAAAGATAAGCCTCTGTTGATCAGGAG
GGATACCCTCCTTATCTTGAATCTTAGCTTTCACATTATCAATAGTATCTGAACTCTCAACCTCCAAAGTAATAGTTTTTCCAGTTAAAGTCTTAACAAA
AATTTGCATTCCGCCTCTCAATCTAAGCACCAAATGAAGGGTAGATTCCTTCTGGATGTTATAATCAGCTAGGGTCCTTCCATCTTCTAGTTGTTTCCCT
GCAAAGATAAGCCTCTGCTGATCAGGAGGGATACCCTCTTTGTGATGGTTTTTCCAGTCAAAGTCTTTACGAATATCTGCATTCCACCTCTCAATCTAAG
CACCAAATGAAGGGTAGATTCCTTCTGGATGTTATAATCAGCTAGGGTTCTTCCATCCTCGAGTTGTTTCCCAGCAAAGATAAGCCTCTGCTGATCAGGA
GGGATTCCCTCTTTGTCTTGAATCTTGGCCTTGACATTATCAATTGTATCTGATGATTCCACCTCAAGGGTGATGGTTTTACCAGTCAATGTTTTCACGA
AGATTTGCA