Detailed information on CNT30144977


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30278532Medicago truncatulaChenopodium quinoa31.8126.6682.59293forward
CNT30728459Medicago truncatulaCorchorus capsularis38.4457.181.07354forward
CNT30629341Medicago truncatulaVigna unguiculata43.2136.4584.92398forward
CNT30164689Medicago truncatulaPistacia vera57.6596.5581.54531forward
CNT30561419Medicago truncatulaActinidia chinensis61.5689.8680.25567forward
CNT30605054Medicago truncatulaGossypium raimondii31.8151.6887.71293forward
CNT30120413Medicago truncatulaCitrus clementina87.95100.1280.49810forward

Expression of CNT30144977

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MPSCIVQISIPIAAIGSKSGFSSSKYSGFGIS*

>peptide 2 (65 aa)
MVFNILSGLWILMPEDEVNLICCPTLVWTKHDRIWRFVVKSLGFPTTLLGLKIFDICTTTFKAIL*

Sequence

>CNT30144977
CTCTGACTCAGCTGCTGCCTCCTCTTCAGCCTTCTGCTTCTCTTTCTCAATGTTAAACTTGGGTTTCCATGTAGTTTCACGATAGGATTCTGCAATCTTA
TCATCCTTAGCTATAAGAACATTATCAAATAGAATGCCGTCCTGCATTGTCCAAATTTCAATACCAATAGCAGCAATAGGCTCAAAGTCAGGTTTCTCAA
GTTCAAAGTACTCTGGGTTTGGAATCTCCTGAGGCTTCCATATACCCTTATAAGCTGGGTTATCAATGAAGGGGGCACTCCATTTTCCCTTATAAGCTGG
GTTCCTCTTCGTTGGCCTCTTCCACTCACCACAACCAGGGGCTGTTTCACACTTTGGGTTTTCAATTTTGGGAGCTTCCCATTCACCATCCTCCTCATCA
TCCCAATCTTCAGGTTTTGTTGCCTCCGGGATCAGGGATTGTCTTGGAAGGGATAAGAGAAGGCTCAAAATCCTCCTCGGATAGGAAGTTAGCCTTTTTC
TTCTCCTCGCCGTCAACTAGAATTCTCAACTCATTATCAGGCTTTAGAATGGCAGTGTACACATGAGATAGTTTGTCAGATGGGACAGAAGGGGGGAACT
TGAGATGGTGTTCAACATACTTTCCGGTCTTTGGATTCTTATGCCTGAAGATGAAGTGAACCTTATTTGTTGCCCCACACTTGTCTGGACCAAACATGAC
AGAATATGGAGATTCGTTGTCAAATCCCTTGGGTTTCCAACCACTCTCCTGGGGTTGAAGATATTTGATATATGCACCACCACATTCAAGGCCATTCTGT
AGGCGAGTCTCAAACTGAAGAACAACTGATCCATCCTTAAGAATGACAGGTTCGTCAAGTTCTTTAACTATGGCGTACTTCCTTGCTGGTTCACTAACAA
GAAGTCCAAAATCGTCGTGCC