Detailed information on CNT30144863


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30513114Medicago truncatulaJuglans regia20.3469.982.67202forward
CNT30631290Medicago truncatulaVigna unguiculata6.5520.1292.3165forward
CNT30506853Medicago truncatulaNicotiana attenuata11.1835.1386.49111forward
CNT30171733Medicago truncatulaTrifolium pratense28.540.4396.47283forward
CNT30573808Medicago truncatulaVitis vinifera24.6738.5282.86245forward

Expression of CNT30144863

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MNSITKSVEDEAKYSSFPASYHFGTLMIPMLEANL

Sequence

>CNT30144863
TTTCGAAAGGGTTAAGCTAGATTCAACCCATATTCTAAGAATTGTAATAGATGTTTAATTTCTATTTATTATGCTTGATAATATAAAGAGTAATATAAAG
CCATCTTAGTTCCTCTGTACATGGAAATAGATTAAGGATCATAACAATCATGCCCGGATGTCTTTCAAAATTCATCCATTCAGGATTACATTAGAATAAC
ATAGGCTTTCATGTCATTGGATACATCAAAGATTTTAGTTGCTGCCACTCAGTGTTTGAACAATGGTGTTGTGCCATGGGTCTGAAAGGTGCTGCAAGAG
GTTATCAAATGGTCCTTTTCCTGTCACATTGTGCTGAATGATAAATCCCAAGAATGCCAACATTGCCAATCTCCCTGCAAACATTTGAAATACACAAGTT
TAACTCCAAAGTTTCATAATAAAAAAGACAGGTTAAATATAATTGTAATCCTTATGAAATTGATCAAATTTGATTTGTTAATTAGGTATGGTCAAAAATA
TATTTAAGCAAAGACTTTTTTTTTTTAAGAAGCTAAATTAGTCGACCTAAATTGGCACCGGGGAGCATCGAACCTGAGACCTTAAGGAGGAGCACACTCC
CAGCTCCCAAGTGAATACCACCAGGCCAACCCAGGTACCATTTAAGCAAAGACTTTAATGCAGTATTTCAGGCATAGCTAGAGAGTAGAGATAATAAAGC
ATTTACCATTAGCAATTTCCTTCTCTTTAGCCTCCAAAGTTGGTGCAAAGTTCAAAGGGTTAAAAATTCCACCGGGGTAACCAACCTCACCCTTTGGCAA
ACTGTATTGCTTGAAGATAGGATCTTGGTTAACGCTACCAGGGTTCTTAATGTCTTGCCATCTTCTAATCTCGACGTAATGGAACAAAATGAACTCGATC
ACAAAGAGTGTTGAAGATGAAGCAAAGTATTCTTCTTTCCCTGCATCATACCATTTTGGAACGTTGATGATTCCAATGTTGGAAGCGAACCTA