Detailed information on CNT30142663


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30142663

Peptides detected in this lncRNA

>peptide 1 (88 aa)
FFNPPKTLDIFPSSSSSLSLLSNSRSNGFCNRRIAFHLLLLRTPRCHRPRATCVSPICFHRPSVASPSIRGAHTDLLLVSLSPPRFAS*

>peptide 2 (72 aa)
MASAIEELRSTSFSCELLAVTGRGRRVSRRFASIGHLLHRLAYAARTPISCWFRFRLPDLPPKGPASSSPES*

>peptide 3 (33 aa)
MIFLQVVQLLSQACCLPLPKLRSAIAELCDVNT*

>peptide 4 (36 aa)
MEHIMMHDDIKQSSWISRFIVIHVGTSVHFCNMDAT*

>peptide 5 (67 aa)
MVKTVHEDGEALVVQSQEKKKRRLPPKFRLWIGSPDVSVGFSFPVLLHVTFLLLSSISLFPNPHVLL*

>peptide 6 (78 aa)
MQGVATSLGQQLHLVRKLDSEHTDDFLASCAVVVSSLLPPFAKTKKCNSRIMRCKYMKVTNFLTTDMMAIYHGTYYDA*

>peptide 7 (32 aa)
MASAHTSLQRLSYFVTDRCKGWRPAWGSNCIL*

>peptide 8 (32 aa)
MSYATGGGLHTSVPTQSVAVLPHEKGNYSSGS*

>peptide 9 (30 aa)
MYLGWRTVMHILVVPQPLFNGKSAQRQIKS*

>peptide 10 (34 aa)
MSRLAFPFLSCCMLRSCFSPLFLYSPTLMYFCNL*

Sequence

>CNT30142663
CTTCTTTAATCCTCCGAAAACCCTAGATATTTTTCCTTCCTCTTCCTCCTCTCTCTCTCTCCTTTCCAATAGCAGGAGCAATGGCTTCTGCAATCGAAGA
ATTGCGTTCCACCTCCTTCTCCTGCGAACTCCTCGCTGTCACCGGCCGCGGGCGACGTGTGTCTCGCCGATTTGCTTCCATCGGCCATCTGTTGCATCGC
CTAGCATACGCGGCGCGCACACCGATCTCTTGTTGGTTTCGCTTTCGCCTCCCCGATTTGCCTCCTAAAGGCCCAGCATCAAGCTCTCCCGAGTCCTGAG
CAGCGGCGGATGGCATCGGCGCACACGTCTCTCCAGCGGCTAAGCTATTTTGTGACAGATCGATGCAAGGGGTGGCGACCAGCTTGGGGCAGCAACTGCA
TCTTGTGAGAAAATTGGATTCAGAACATACCGATGATTTTCTTGCAAGTTGTGCAGTTGTTGTCTCAAGCTTGCTGCCTCCCTTTGCCAAAACTAAGAAG
TGCAATAGCAGAATTATGCGATGTAAATACATGAAAGTAACAAATTTCTTGACAACAGATATGATGGCTATTTACCATGGAACATATTATGATGCATGAT
GATATTAAACAAAGCAGCTGGATAAGCCGTTTTATTGTCATACATGTAGGCACTAGTGTTCACTTTTGCAATATGGACGCTACGTAGCTACATATGTCTT
AAATTCTGTAGTGAGCAAAATGTATTTAGGATGGCGGACGGTTATGCACATTTTGGTAGTGCCACAACCACTATTTAATGGCAAATCAGCTCAAAGACAA
ATAAAGTCATAACAGAGACTTTGGGGAGCAGTCAAAGGTGCAAACTAGGAGTGGTTGCGGATCAACACTCTGATTGGTTCATACAGAGAATCCACCTTCG
TTCAGATTGGCAACGGTGAATGTACAGCCTCGTGGAAAGATAAATGGACAAGCAACAAGCCATTGCACATTCAGTTCCCTGCTTTGTTCTCACATACTAA
TTGACCGAACATCTTGGTCGTTGATTGCTTTCAGAACGGAGAATGGGTGATACCTTTGATGCATATTACTCCGGATCGTGCTGAACAAGAAAGGTGGAAT
TGCTGGCCTTCCTGAATGCATGCTCTCTTGACTCGCCAACTCCAGATAGGAGAGGATGGAAACTGAATATTACAGAGTCCTTCTCAGTCAAAAACATGTA
ATATGAGTTATGCAACTGGGGGTGGATTGCACACTTCAGTGCCAACACAATCTGTAGCTGTGCTGCCCCATGAAAAGGGAAATTATTCGTCTGGCTCATG
ATAAAAAGAAGGATCAAAGGTTAGGACAGTTTTGTTCAAACAACACTGGATGATGAACTCTGCCCCTTTGGGTGCAAAGAAAAGAATCAGTTGAACACTT
AACATTGTACTGTCGTCGGACCAAACAAAATCATGGCGATGTTCGGTATTCAGCTGACTGGTGTTAATGATCTGGATAACATCTACTTGGAAGCAAGAGA
GTGATGTTCAGACATGAAAAAAATTTATGCATGGGGCCTGGTTATAACGGCTGTGTACTGAGTGTCAAGAAACAGAAAGGTTTTTGACAAAATAGTTGAC
AGTTGCAGTGGTGGCTAGGCAGTGCATCGAGATGGTGAAGACAGTGCATGAAGATGGTGAAGCTCTAGTCGTTCAGAGCCAAGAAAAAAAGAAAAGGAGG
CTGCCACCAAAGTTTCGATTATGGATTGGCAGTCCTGATGTCTCGGTTGGCTTTTCCTTTCCTGTCTTGTTGCATGTTACGTTCTTGCTTCTCTCCTCTA
TTTCTCTATTCCCCAACCCTCATGTACTTCTGTAATCTGTAATTTTGGAGCCCTGGTGTCTCACCTTGTTTTAATGAAAATCAGGTAAGGACCTCCCCTC
CCGACCTTGTGCACAAAAATGAAAGGATTTTCAGCAGAATTGTTAGCAAACTGATAGTTTCGCAGTAGAAGAGTTCTGCTTAAACTTTTAATGAGGGGAA
TTTCTGGAGTCCTTGTAATTGTAAAGCAGGACTGTGACCTGTGACTCTGTGATAAGCCTTTATTTTGAAAACATCTGGAGTTTGTAGTAACGTTCA