Detailed information on CNT3014191


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3014191

Peptides detected in this lncRNA

>peptide 1 (56 aa)
PPPTLSLILNVLSPDVVLGRCPHCSSLTHVLTMLHSSSTRSIGLSPVSLPNYSCPK*

>peptide 2 (88 aa)
MLLHEWGYMRETILLLQLTYNTNVWNPVVCLYVSTGTMSHIDTGIHLSDKQSSGMKSRVSHINGTHVYFLGTQKCILLIAKAYLRQRII

>peptide 3 (44 aa)
MGLYEGDYSLTTANLQYKCLEPCCVSLCINWNNEPYRYWDPSIR*

>peptide 4 (92 aa)
MYFPLTLSSAVAHIAQASRTCSPCSTLPRRALLASHQSRCQTIVVQNDNAVTAKLTKGHSRKILTEVQDYDYGSANSRHDPRRRPGTGGRNG*

Sequence

>CNT3014191
TGCCCCCGCCCACCCTATCCCTAATTCTCAATGTACTTTCCCCTGACGTTGTCCTCGGCCGTTGCCCACATTGCTCAAGCCTCACGCACGTGCTCACCAT
GCTCCACTCTTCCTCGACGCGCTCTATTGGCCTCTCACCAGTCTCGTTGCCAAACTATAGTTGTCCAAAATGATAATGCTGTTACTGCAAAGTTGACAAA
GGGGCATAGCAGAAAGATTCTTACAGAGGTTCAGGATTATGATTACGGAAGTGCAAACTCTAGGCATGATCCACGCAGAAGGCCTGGGACTGGAGGTAGG
AATGGCTAGAGTGCTAGACCACTAAGCTCCTTATTATACAGTCTGTATATAATTGTGTGAAGATGCTACTACACGAATGGGGTTATATGAGGGAGACTAT
TCTCTTACTACAGCTAACCTACAATACAAATGTTTGGAACCCTGTTGTGTGTCTTTATGTATCAACTGGAACAATGAGCCATATAGATACTGGGATCCAT
CTATCCGATAAACAGTCTAGTGGGATGAAGTCAAGAGTATCTCATATAAATGGCACCCATGTGTACTTTTTAGGCACCCAAAAATGTATTCTGCTAATTG
CTAAAGCATACCTGAGGCAGCGCATCATCT