Detailed information on CNT30141909


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9FJ45|GDL83_ARATH, E-value = 1e-17

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30521520Lolium perenneSetaria italica56.1266.890.91165forward
CNT30387862Lolium perenneTriticum turgidum23.4718.5591.369forward
CNT30216931Lolium perenneKalanchoe fedtschenkoi20.076.789.8359forward
CNT30687841Lolium perenneTriticum urartu30.2727.4786.5289forward
CNT30342495Lolium perenneEragrostis tef24.1518.5495.7771forward
CNT3099548Lolium perenneOryza rufipogon23.4718.2585.5169forward
CNT30583167Lolium perenneEchinochloa crusgalli57.1464.1292.86168forward
CNT30117045Lolium perenneOryza nivara62.2468.893.99183forward

Expression of CNT30141909

Peptides detected in this lncRNA

>peptide 1 (96 aa)
QAERLGEEVDDEAAVGAAACGAAEEGFAVGGLGEGEACRGAVHAEVAGVGDGVAEAVDGVELLPGHGQGARHQEERHQQRRRRHCWLARSTGNTDRS

>peptide 2 (29 aa)
GRPSDWARKSTTRRPSEQRHVARPKKVSP*

>peptide 3 (33 aa)
AGRATGRGSRRRGGRRSSGMWRGRRRFRRRGAG*

>peptide 4 (29 aa)
MALNFCPDTAREHDTRRSATSSEDDAIVG*

Sequence

>CNT30141909
GGCAGGCCGAGCGACTGGGCGAGGAAGTCGACGACGAGGCGGCCGTCGGAGCAGCGGCATGTGGCGCGGCCGAAGAAGGTTTCGCCGTAGGGGGGCTGGG
TGAGGGTGAGGCCTGCCGGGGGGCCGTTCACGCAGAGGTTGCCGGTGTCGGAGATGGAGTCGCCGAAGCTGTAGATGGCGTTGAACTTCTGCCCGGACAC
GGCCAGGGAGCACGACACCAGGAGGAGCGCCACCAGCAGCGAAGACGACGCCATTGTTGGCTAGCTCGGAGCACTGGGAATACTGATCGCTCGA