Detailed information on CNT30141888


BLAST search results

BLAST vs Swiss-Prot:
sp|A2Y886|PLAS_ORYSI, E-value = 1e-63

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673857Lolium perenneSetaria viridis41.6232.4586.88221forward
CNT30226316Lolium perenneHordeum vulgare18.0822.5992.7196forward
CNT30391774Lolium perenneTriticum turgidum25.4222.8496.3135forward
CNT30443574Lolium perenneAegilops tauschii54.9953.2894.18292forward
CNT30663028Lolium perenneTriticum dicoccoides30.3234.2695.03161forward
CNT3010819Lolium perenneZea mays35.2250.1386.63187forward
CNT30368525Lolium perenneSorghum bicolor39.9235.9388.21212forward
CNT30596432Lolium perenneOryza meridionalis21.6619.0793.04115forward
CNT30370409Lolium perenneOryza glumipatula54.2436.9791.32288forward
CNT30148503Lolium perenneBrachypodium distachyon31.8353.9992.9169forward
CNT30102318Lolium perenneOryza rufipogon54.2446.4591.32288forward
CNT30583031Lolium perenneEchinochloa crusgalli54.2433.2686.46288forward
CNT30116921Lolium perenneOryza nivara51.7941.1791.27275forward
CNT30557376Lolium perennePanicum hallii29.9453.3687.42159forward

Expression of CNT30141888

Peptides detected in this lncRNA

>peptide 1 (58 aa)
MLCGNPALFLKVMVSPALTLKSLGSNTSTPPLAPRSTKGRSRLQRKGRPLLRSGVSTE*

Sequence

>CNT30141888
GACATAAACAGATTGTTATATGATGATGGTATGAAGGAGCGCGAGTACTTATAAACAATAGGCTCATCGATCGATCGATCTTATAATACATAAAACAGAT
CGTAGTACAATTGATTGGCACGTTCAAATTTGGTGGCAAGAGCAAGACAGCTAAGCTTAGTTGACGGTGACCTTGCCGACCATGCCGGCTCCGGCGTGTG
GCTCGCAGTAGAAGCCGTACGTCCCGGGCACGGTGAGGGTGACGGAGAAGGTCTCGCCGGGGGCGTTGAGGTACTCCTCCTGGGAGATCTTGGCGACGTC
GACGCCGGACGGCACGGCGTCCTCGTCGAACACAATGTTGTGTGGGAACCCGGCGTTGTTCTTGAAGGTGATGGTCTCGCCGGCCTTGACGCTGAAGTCG
TTGGGCTCGAACACCAGCACGCCGCCGTTGGCGCCGAGGAGCACGAAGGGACGGTCACGGTTGCAGAGGAAAGGGCGGCCATTGCTCCGATCTGGTGTTA
GTACCGAGTGAGTGGCGCAGCTAGGTAGGGC