Detailed information on CNT30141570


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 7e-177

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30193041Lolium perenneSecale cereale83.054892.12926forward
CNT30593897Lolium perenneEragrostis curvula82.5181.9291.2920forward

Expression of CNT30141570

Peptides detected in this lncRNA

>peptide 1 (61 aa)
MRRCWSGGMPSLSWILALTLSMVSDDSTSRVMVLPVRVLTKICMPPRSLSTRWRVDSFWML*

>peptide 2 (62 aa)
MVRHLLTTTEAEHQVQGGLLLDVVVRQGATVLQLLTSEDQTLLVRRNALLVLDLRLHVVDGV*

>peptide 3 (53 aa)
MPSLSWIFAFTLSMVSDDSTSRVMVLPVRVLTKICMPPRRRSTRWRVDSFWML*

>peptide 4 (61 aa)
MRRCWSGGIPSLSWIFAFTLSMVSEDSTSRVMVLPVRVLTKICMPPRSLSTRWSVDSFWML*

>peptide 5 (45 aa)
MRRCWSGGMPSLSWIFAFTLSMVSEDSTSRVMVLPVRVFTKICICK

Sequence

>CNT30141570
GTTCAGGACTCACTTATTCATTCATTCAAAGTTCAAAGATGCTGCATCACAGCATAAGTTTGTAGACACAAGGTGACATAACACGAGACCACAATACAAC
AGAATCACAGGACCAGACCACCCGAGACACACACCGAAGGAACCAGACTTGTGAACCCCAGGAGAGAGAAACAGTGCCATGGTTAGGCACTTACTGACCA
CCACGGAGGCGGAGCACCAGGTGCAGGGTGGACTCCTTCTGGATGTTGTAGTCCGCCAGGGTGCGACCGTCCTCCAGCTGCTTACCAGCGAAGATCAGAC
GCTGCTGGTCCGGAGGAATGCCCTCCTTGTCCTGGATCTTCGCCTTCACGTTGTCGATGGTGTCTGACGACTCCACCTCCAGGGTGATGGTCTTGCCGGT
GAGGGTCTTGACAAAGATCTGCATGCCACCACGAAGGCGGAGCACCAGGTGGAGGGTGGACTCCTTCTGGATGTTGTAGTCAGCAAGGGTACGGCCGTCC
TCGAGCTGCTTGCCAGCAAAGATGAGGCGCTGCTGGTCCGGAGGGATGCCCTCCTTGTCCTGGATCTTGGCCTTGACATTGTCAATGGTGTCAGATGACT
CCACCTCCAGGGTGATGGTCTTGCCAGTGAGGGTCTTGACAAAGATCTGCATGCCACCACGGAGCCTGAGCACCAGGTGGAGGGTGGACTCCTTCTGGAT
GTTGTAGTCAGCGAGGGTGCGGCCATCCTCCAGCTGCTTGCCAGCGAAGATGAGGCGCTGCTGGTCCGGAGGGATACCCTCCTTGTCCTGGATCTTTGCC
TTCACGTTGTCGATGGTGTCCGAGGACTCCACCTCTAGGGTGATGGTCTTGCCGGTGAGGGTCTTGACAAAGATCTGCATGCCACCACGGAGCCTCAGCA
CCAGGTGGAGCGTGGACTCCTTCTGGATGTTGTAGTCAGCGAGGGTGCGGCCGTCCTCAAGCTGCTTGCCAGCGAAGATGAGGCGCTGCTGGTCCGGAGG
GATGCCCTCCTTGTCCTGGATCTTCGCCTTCACGTTGTCGATGGTGTCTGAGGACTCCACCTCGAGGGTGATGGTCTTGCCAGTGAGGGTCTTCACAAAG
ATCTGCATCTGTAAA