Detailed information on CNT30141266


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30141266

Peptides detected in this lncRNA

>peptide 1 (45 aa)
VLSSLSIFIFSESNFYIHITAIHAILIRCTKRNGSTRYTISVTVK*

>peptide 2 (42 aa)
LCSAHCPSLFSLNRTFTFISRLYMQFLFGVLSGTEVHDIRYQ*

Sequence

>CNT30141266
CTGTGCTCAGCTCACTGTCCATCTTTATTTTCTCTGAATCGAACTTTTACATTCATATCACGGCTATACATGCAATTCTTATTCGGTGTACTAAGCGGAA
CGGAAGTACACGATATACGATATCAGTAACGGTTAAGTAAGGCCGTGGCAGTAACTTGTACTGCTAGTGCAAGGCATGCATCATTATCAAGGTCGTCCAA
TCCCCCCATCGTTCGGGGGAGGAGCTCCTCTGCGGTAGGGTGGATAATAAGGACGGCCGGGGTAGGGGATATACGGACCGCCAGGGTAGCGCCCGCAGGG
ACGTCCACGGGGGCACACCGCGGGGCGGTTAGGATCGAACGCACCACCTGCAAGGAAAACGCAAGCATTTTCCATGGATATTCAGTCATAAGTAACAAGA
TCTTAGAACGCT