Detailed information on CNT30141122


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673679Lolium perenneSetaria viridis38.8952.0390.91154forward
CNT30521377Lolium perenneSetaria italica43.1826.891.81171forward
CNT30668585Lolium perenneTriticum dicoccoides45.221.5482.12179forward
CNT30476611Lolium perenneSaccharum spontaneum45.4525.990.56180forward
CNT30368505Lolium perenneSorghum bicolor34.3422.2288.24136forward
CNT30147657Lolium perenneBrachypodium distachyon20.233.7683.7580forward

Expression of CNT30141122

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MGLTLQKLFLFYYRTAFSGHLFEEKQFPAGRS*

Sequence

>CNT30141122
GTTACTGGTACGAGTTCTCCTAGACTTTGATCACCCCTAATCTCTCCATGACTTGCTGGGCAAAAAATTAAATGGGTTTAACCTTGCAGAAACTCTTTCT
TTTTTACTACCGTACAGCGTTCTCAGGGCATCTTTTTGAGGAAAAGCAATTTCCCGCCGGCCGGAGCTAGAGGTTAGCTCCTAGGACGAAAGGGCCGGGT
GGCAGTAGGCCCCGCTGACCCATCCGTCGGCGATCTTCTTGTACGCCGCCTCCGTCAGGTGGATCCCGTCCCAGCTCAGCGACGACGCTGGGTTGCCGCA
CGCCGACGCGCCGGACATGCCGCACCTGGCGCCGTTCTGGTAGTTGTACTTGCCGCCGCCGGCACCGCAGCACGCCCTCAGGTTCGTGCTGAACCC