Detailed information on CNT30141022


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 4e-158

BLAST vs NONCODE:
NONMEST001181, E-value = 9e-130

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30242941Lolium perenneAvena sativa71.9168.9394.85699forward
CNT30689822Lolium perenneTriticum urartu71.448.1394.52694forward

Expression of CNT30141022

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MWYLTLLTGSCLLKVHLFIHHGSIHSYCTTADVCRQI*

>peptide 2 (53 aa)
MPSLSWIFAFTLSMVSDDSTSRVMVLPVRVLTKICIPPRRRSTRWRVDSFWML*

>peptide 3 (61 aa)
MSRCWSGGIPSLSWILALTLSMVSDDSTSRVMVLPVRVLTKICMPPRRRRTRWRVDSFWML*

>peptide 4 (45 aa)
MRRCWSGGIPSLSWIFALTLSMVSEDSTSRVMVLPVRVFTKICICK

Sequence

>CNT30141022
CTTCTATGGCTAAACTAGGTTTTCTCCTTGTTGGATGTGGTATCTGACTCTTCTGACAGGTTCCTGTCTCTTGAAGGTTCACTTATTCATTCATCACGGT
TCAATTCATAGCTACTGCACCACGGCAGATGTTTGTAGACAAATATGATATCACACTAGACAACAAAACGGCAGGAAAAGAAGATAATCGACCACTCGAC
CAGAACAACTGACATCCCCAGTGGAGGACACCGAAGACCCCACAGTTGAGAACCCTCAGAGATTGAATCAGCTCCTTACTGGCCACCACGGAGGCGGAGC
ACCAAGTGAAGGGTGGACTCCTTCTGGATGTTGTAGTCCGCCAGGGTGCGGCCATCCTCCAGCTGCTTACCAGCAAAGATCAGACGCTGCTGGTCTGGGG
GGATGCCCTCCTTGTCCTGGATCTTCGCCTTCACGTTGTCGATGGTGTCTGACGACTCCACCTCGAGGGTGATGGTCTTGCCAGTGAGGGTCTTGACAAA
GATCTGCATACCACCACGGAGGCGGAGCACCAGGTGGAGGGTGGACTCCTTCTGGATGTTGTAGTCGGCGAGGGTACGGCCGTCCTCAAGCTGCTTGCCA
GCGAAGATGAGTCGCTGCTGGTCCGGAGGGATACCCTCCTTGTCCTGGATCTTGGCCTTGACGTTGTCAATGGTGTCAGACGACTCGACCTCAAGGGTGA
TGGTCTTGCCGGTGAGGGTCTTGACGAAGATCTGCATGCCACCGCGCAGGCGGAGAACCAGGTGGAGGGTGGACTCCTTCTGGATGTTGTAGTCAGCGAG
GGTACGGCCGTCCTCGAGCTGCTTGCCAGCGAAGATGAGACGCTGCTGGTCCGGAGGGATACCCTCCTTGTCCTGGATCTTCGCCTTGACATTGTCGATG
GTGTCAGAGGACTCCACCTCGAGGGTGATGGTCTTGCCGGTAAGGGTCTTCACAAAGATCTGCATCTGTAAA