Detailed information on CNT3014096


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3014096

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MASKTKRVCIDGLVIGAVLTTLVIAVQQRLLTRL*

>peptide 2 (83 aa)
HCDVDELKMEIPLPQKNPPTASPSIPNVSGPTPSLFLPPYNITRLAPSSPAQQQTQPNPCASSSAVARARHPSIDHSPLPESP*

Sequence

>CNT3014096
CACTGTGATGTTGATGAGCTGAAGATGGAAATTCCGCTCCCCCAGAAGAATCCTCCAACTGCTTCCCCATCAATTCCAAACGTATCTGGGCCAACACCTT
CCCTGTTTCTTCCACCTTACAACATAACTCGACTCGCTCCTTCGTCGCCTGCTCAGCAACAGACGCAGCCAAATCCGTGCGCATCATCATCTGCTGTTGC
ACGTGCTCGACATCCTTCAATCGATCACTCACCACTACCAGAGTCTCCATGACCTTGCTCAAACTCTCCTGAGTTTGCCTATCTCGATCCGCCATGGCTT
CCAAAACAAAACGTGTCTGCATCGATGGTTTGGTGATAGGCGCCGTATTGACAACGCTGGTGATCGCTGTCCAGCAACGACTGCTGACCCGTCTTTGATA
CCAAGTGTGAGACCCGTGGCCGGAGTAGCGCCAACTCCGACGTGAGCACCCACGGTGGCTGCCTCCGAGGGAAGGACAAGCGCAGGTGTAGGAGTCTAAA
TAGCCGGCTTTAATCAAAGAGATCAGCGAGATGCC