Detailed information on CNT30140884


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694484Lolium perenneOryza sativa27.1717.9390.7297forward
CNT30673933Lolium perenneSetaria viridis26.0514.5588.1793forward
CNT30554101Lolium perenneOryza glaberrima27.1715.1690.7297forward
CNT30474747Lolium perenneSaccharum spontaneum27.739.4687.8899reverse complement
CNT30368472Lolium perenneSorghum bicolor27.7323.1987.8899forward
CNT30370564Lolium perenneOryza glumipatula27.1720.0490.7297forward
CNT30102264Lolium perenneOryza rufipogon27.1714.1890.7297forward
CNT30576633Lolium perenneOryza barthii27.1719.3690.7297forward
CNT30117076Lolium perenneOryza nivara27.1719.2190.7297forward
CNT30593373Lolium perenneEragrostis curvula22.4113.5186.2580forward

Expression of CNT30140884

Peptides detected in this lncRNA

>peptide 1 (98 aa)
MERVILGTSGEGQHPPVAPTRSSIRYMTREKVKHHNVEAKLDNSSTQMDRILMRPDTTTAAGPLQGSFTRHRPHPAEWKQTMFRYLNSLERLQACTNYG

Sequence

>CNT30140884
GCAATTTAATCTAACATTACCAAACTGATGTTACCACAATGTTAGCCGCTCAGTGACAATGGAAAGAGTAATTCTAGGTACAAGCGGGGAAGGACAGCAC
CCGCCGGTGGCGCCAACAAGGAGCTCTATCCGTTATATGACGAGAGAAAAGGTAAAACATCACAATGTTGAAGCGAAACTGGATAATTCTAGTACACAGA
TGGATAGGATCCTTATGAGGCCAGACACCACCACCGCAGCAGGCCCCTTGCAGGGAAGCTTCACTCGTCATCGTCCTCATCCTGCGGAATGGAAGCAAAC
TATGTTCAGATATCTAAACAGTCTTGAGAGGCTTCAAGCATGTACCAACTATGGTTA